DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and p4ha2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_005173949.1 Gene:p4ha2 ZFINID:ZDB-GENE-030827-1 Length:542 Species:Danio rerio

Alignment Length:537 Identity:135/538 (25%)
Similarity:233/538 (43%) Gaps:99/538 (18%)


  Fly    13 LFLLVESVAGANFARGE-----EQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEI-H 71
            |..|:.:::.::..|.|     .|:..|:.||.:|:..|::||:..|::||.:|...:.:::: .
Zfish     5 LVFLLSTLSFSSPTRAEIFTSIGQMTNLIFTERELVQSLKEYIQAEEQKLETVRSWANKLDKLTR 69

  Fly    72 SQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNH 136
            :.....|.::.:|:|.:.::||..:.|..||..........|...:|..:...|.|||.:.:...
Zfish    70 TSTSDPEGFLAHPVNAYKLMKRLNTEWSELESLVLQDPSDGFISNMSVHRQYFPDEEDEKGAAKA 134

  Fly   137 LLHLQSVYELDSNSLSLGVV------NGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALE 191
            ||.||..|:||:.|.|.|.:      :|.:..:.::..||.::.:    .:|:..:..|::.:|.
Zfish   135 LLRLQDTYKLDAESFSKGKLPGQRQHSGVRYNALLTVDDCFDMGKMAYNDNDYYHSVLWMQQSLR 199

  Fly   192 KLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIE 256
            ::.|..|..|.        :..:|:......|:.|:|.||:.....||.:.|.:|......|..|
Zfish   200 QMDSGEEAKTP--------KADVLDYLSYSVYQMGDLPRAIELTRRLLAIDPSHQRAGGNLRYFE 256

  Fly   257 KAMAKKELPKGRGQKSKA-KKQISKST---------EQLLIEEICRGAKQQVTT--GSRFNHCQL 309
            :.::|:....|:.|...| ::.|...|         |:...|.:|||...::||  .||......
Zfish   257 RLLSKELQDSGQTQPEPADERPIQLDTYQRPKDYLPEREAYEALCRGEGVKMTTKRQSRLFCRYR 321

  Fly   310 DGS-SPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQK 373
            ||: :|.|||:|.:.|.....|:||...:.|    |:|.:|.|.|      ::...|..:.:...
Zfish   322 DGNRNPRLLLKPMKEEDEWDSPHIVRFLEAL----SDEEIQKIKE------IATPKLARATVRDP 376

  Fly   374 KLG-------RISRLLGLEILELDPWTGRRHGH-EHITKLE-HSSELKHVA-------------- 415
            |.|       |:|:...|| .|.||...|.:.. |.||.|. .::||..||              
Zfish   377 KTGVLTVAHYRVSKSAWLE-GEDDPVIARVNQRIEDITGLTVDTAELLQVANYGVGGQYEPHFDF 440

  Fly   416 ----------------------RLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSS 458
                                  ..|.:::|   |||.|||....:|...:|:.:.|...|..|  
Zfish   441 SRKDEPDAFKSLGTGNRVATYLNYMSDVEA---GGATVFPDFGASVWPRKGTAVFWYNLFRSG-- 500

  Fly   459 SEWDYRSGQAICPVLLG 475
             |.|||:..|.||||:|
Zfish   501 -EGDYRTRHAACPVLVG 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/127 (28%)
p4ha2XP_005173949.1 P4Ha_N 25..154 CDD:285528 36/129 (28%)
P4Hc 353..526 CDD:214780 47/178 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.