DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4ha2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001101745.1 Gene:P4ha2 RGDID:1309673 Length:535 Species:Rattus norvegicus

Alignment Length:519 Identity:131/520 (25%)
Similarity:231/520 (44%) Gaps:64/520 (12%)


  Fly     7 VLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH 71
            ||.||..:..|.|...|.|......:..|:..|..|:..|::||...|.:|.:|:...|.:|.:.
  Rat     5 VLVLLMSWFGVLSWVQAEFFTSIGHMTDLIYAEKDLVQSLKEYILAEEAKLSKIKSWASKMEALT 69

  Fly    72 SQ-VDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLN 135
            |: ....|.|:.:|:|.:.::||..:.||.|...........|...||.::...|::||...:..
  Rat    70 SKSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDAAAGFVANLSVQRQFFPTDEDESGAAR 134

  Fly   136 HLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLPSA 196
            .|:.||..|:||.:.:|.|.:.|.|..:.:|..||..:.|    :.|:.....|:|..|::| .|
  Rat   135 ALMRLQDTYKLDPDMISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQL-DA 198

  Fly   197 SENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQ----GIQKAKRKIEK 257
            .|.:|.:       :..:|:......::.|:|.||:.....||.|.|.::    .::..:|.:|:
  Rat   199 GEEATVT-------KSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEE 256

  Fly   258 AMAK---KELPKG-RGQKSKAKKQISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQLDGS 312
            ...|   .:...| ..|::..::.:....|:.:.|.:|||      .::|.....|::|   ...
  Rat   257 ERGKSLSNQTDAGLASQENLYERPVDYLPERDVYESLCRGEGIKMTPRRQKRLFCRYHH---GNR 318

  Fly   313 SPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEE------EDTK-GV----SYQSLK 366
            .|.||:.|.:.|.....|:||.::||::.:|...:.::...:      .|.| ||    ||:..|
  Rat   319 VPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSK 383

  Fly   367 LSKLAQKK---LGRISR----LLGL-----EILELDPW--TGRRHGHEHITKLEHSSELK----- 412
            .|.|.:..   :.|::|    :.||     |:|::..:  .|:...|...::.:.....|     
  Rat   384 SSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGMGGQYEPHFDFSRSDERDAFKRLGTG 448

  Fly   413 -HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
             .||..:..:.....|||.|||.|..|:...:|:.:.|......|   |.|||:..|.||||:|
  Rat   449 NRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSG---EGDYRTRHAACPVLVG 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 35/127 (28%)
P4ha2NP_001101745.1 P4Ha_N 26..155 CDD:285528 35/129 (27%)
P4Hc 346..519 CDD:214780 42/168 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.