DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG31013

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733394.3 Gene:CG31013 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster

Alignment Length:511 Identity:123/512 (24%)
Similarity:194/512 (38%) Gaps:115/512 (22%)


  Fly    35 LLDTETQLIDGLRDYIERLERQLEEIRRETSAI--EEIHSQVDSVEEYMGNPLNVFGILKRFESV 97
            ||:.|.:|||.|.:|...||::||.||.:...|  |....:.::: .|:.||||.|.|::|....
  Fly    38 LLELEKKLIDNLENYTNALEQKLEIIRSQLLVIRAENEKGRRNAI-SYLSNPLNGFSIIRRLHQD 101

  Fly    98 WPG----LEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNG 158
            |..    :||.........|.....:    ||:|.|..::...:..:||.|:|.......|.:||
  Fly   102 WINWRKYMEQPVGIWQLKAFYSWKDE----LPTERDLWDACEGIARIQSTYDLKVGDFINGNING 162

  Fly   159 FKLGSSMSWGDCLEVA-------RKSDFPVARFWLESALEKLPSASENSTESQRERESGRVHILE 216
            .:...|||..|.|.|.       |.||   |..||:...::|   .|......|......|..|.
  Fly   163 KQYNDSMSTADILSVGAYLFMKNRPSD---AIQWLQEVPQRL---QEELLIQPRHLPIKEVDALR 221

  Fly   217 ATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRK----IEK-------AMAKKELPKGRGQ 270
            .....:.:....|.||......|.|.|.:..:.:..:|    ||.       ...|:.:|.....
  Fly   222 LLAEAQIKDQNYSEALPLLHNCLKLQPHDARVLRLWKKTTDFIENQPDQSPTENKKRNVPIANAF 286

  Fly   271 KSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLD-GSSPWLLLQPSRLEPVSSDPYIVL 334
            |......:..||..                     ||..: .::|:|.|.|.:.|.:..|||:||
  Fly   287 KLSCNGPLESSTRL---------------------HCFYNFTTTPFLRLAPLKTEQIGLDPYVVL 330

  Fly   335 HHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKL------AQKKLGRISR--LLGLEILELDP 391
            :|:||:.:|.:.|:          |.:.|::|.:|:      .:|..||.::  .|..|..||..
  Fly   331 YHEVLSAREISMLI----------GKAAQNMKNTKIHKERAVPKKNRGRTAKGFWLKKESNELTK 385

  Fly   392 WTGRR----------------------HGHEHI--------------TKLEHSSEL-KHVARLML 419
            ...||                      .||..:              |:..:|.:| ..:|.::.
  Fly   386 RITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRYSIDLGDRIATVLF 450

  Fly   420 NLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            .|.....|||.||..:...|:...|:.:.|......|:.   |.|:..|.|||::|
  Fly   451 YLTDVEQGGATVFGDVGYYVSPQAGTAIFWYNLDTDGNG---DPRTRHAACPVIVG 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 37/127 (29%)
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528 37/127 (29%)
TPR_11 178..248 CDD:290150 16/76 (21%)
TPR repeat 211..246 CDD:276809 6/35 (17%)
P4Hc 336..513 CDD:214780 38/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146325356
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.