DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG32201

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_730346.2 Gene:CG32201 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster

Alignment Length:527 Identity:113/528 (21%)
Similarity:219/528 (41%) Gaps:91/528 (17%)


  Fly     6 SVLWLLQLFLLVESVAGA--------NFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRR 62
            |:|.:|..|.::.|..|.        .::.....|..||..|.:..|.|.:.:::|..:.|.:|.
  Fly     6 SLLPVLLGFAVLNSFVGCVEDIEEKERYSSSTVGLLKLLKVEEKFTDNLLNQVDQLGEKFEALRM 70

  Fly    63 ETSAI-EEIHSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGER----LSDRQL 122
            ..|:: .|:|..::...:|:.||:|.|.:|:|.....|    |.:...:...||.    |.|...
  Fly    71 YLSSVGYELHRSLNEKVQYVSNPINAFSLLRRTHEDLP----KWHEYFKEAIGEGNQSILVDLVK 131

  Fly   123 TLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVA----RKSDFPVAR 183
            .:|::.|...:::.:..::.:|:|..:.|:.||:.|.:....:::.|.:.:.    ::||:..|.
  Fly   132 MVPNDVDMLSAMHGIQRIEKIYDLKIDDLAQGVLQGVQYNVQLTYRDLIAMGNSMYQQSDYQTAA 196

  Fly   184 FWLESALEK------------LPSASENSTESQRERESGRVHILEATLNIEYRAGE-LSRALATA 235
            .|...|.::            |...||              |:....:...::.|. .|....:.
  Fly   197 KWYRIACKRELENPEQLFIQILGDPSE--------------HLHRQYIKSLFKYGSTTSEPSKSI 247

  Fly   236 EELLLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGA-KQQVT 299
            ||..::      :|.::.:::..|:....|:...:..|...|:.:|...  .|..|||. :|:..
  Fly   248 EEAFIM------VQASQEELDNIMSDLNEPQNDVEVEKDLYQVKRSPSN--CELGCRGLYRQKTN 304

  Fly   300 TGSRFNHCQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNEL----LQLID-------- 352
            ...|:.    ..::.:|.|.|.:||.:|.||::.::|:||...|..||    :.:::        
  Fly   305 LVCRYK----STANTFLRLAPLKLEEISLDPFMAMYHEVLYDSEIRELKGQSMNMVNGYASQRNG 365

  Fly   353 -EEEDTKGVSYQSLKLSKLAQKKLG-RISRLLGLEILELDPWTGRRHG-----HEHITKLEHSSE 410
             |..||. |.|.....:.|.::::. ||..:.|...|:.:......:|     ..|........|
  Fly   366 TEIRDTV-VRYDWWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFE 429

  Fly   411 LKHV-------ARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ..::       |.::........|||.|||::.:.|...:||:|:|......|..   |.||..:
  Fly   430 TPNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHDDGKP---DIRSLHS 491

  Fly   469 ICPVLLG 475
            :||||.|
  Fly   492 VCPVLNG 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 32/131 (24%)
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528 32/133 (24%)
P4Hc 341..507 CDD:214780 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146326544
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.