DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4htm

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_001075237.3 Gene:P4htm RGDID:1311848 Length:553 Species:Rattus norvegicus

Alignment Length:326 Identity:68/327 (21%)
Similarity:121/327 (37%) Gaps:97/327 (30%)


  Fly   209 SGRVHILEATLNIEYRAGELSRALATAE-ELLLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKS 272
            :||.|.:. ||:::....|:...|:..| .|::.|...:|:|::          :.||....:::
  Rat   180 AGRDHFIR-TLSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRS----------QILPTEEYEEA 233

  Fly   273 KAKKQISKSTEQLLIEEICRGAKQ--QVTTGSRFNHCQLDGSSPWLLLQPSRLEPVSSDPYIVLH 335
            .:..::|:.....|:::...|..|  :|...:|.      |:..|                    
  Rat   234 MSAMRVSQLDLFQLLDQNHDGRLQLREVLAQTRL------GNGRW-------------------- 272

  Fly   336 HDVLTPKESNELLQLIDEEEDTKGV-SYQSLKLSKLAQKKLGRISRLLGLEILEL-----DPWTG 394
               :||:...|:...|..:.|..|| |.|  :.|.:..:...:..|....|..||     ..|..
  Rat   273 ---MTPENIQEMYSAIKADPDGDGVLSLQ--EFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLH 332

  Fly   395 RRHGHEHITKLEHSSELKHVARL---MLNLQAP------GMGG--------AVVFPQ-----LEL 437
            :..|..|:.:......|: :.||   ::.|..|      |.||        ..|:|:     .:|
  Rat   333 QGEGAHHVMRAIRQRVLR-LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKL 396

  Fly   438 AVN--VP------RGSLLHWRTRFAGGSSSEWDYRSGQAICPVL---LGVQLSVIACQSNV-LRD 490
            ..|  ||      ..::|.:.....||         |:.:.||.   ...::|:|  |.|| |||
  Rat   397 VANESVPFETSCRYMTVLFYLNNVTGG---------GETVFPVADNRTYDEMSLI--QDNVDLRD 450

  Fly   491 T 491
            |
  Rat   451 T 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4htmXP_001075237.3 EF-hand_7 243..303 CDD:290234 17/91 (19%)
EFh 245..303 CDD:298682 17/89 (19%)
P4Hc 297..509 CDD:214780 38/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92090688
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.