DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and phy-4

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans

Alignment Length:237 Identity:45/238 (19%)
Similarity:80/238 (34%) Gaps:83/238 (35%)


  Fly   251 AKRKIEKAMAKK--ELPKGRGQKSKAKKQISKSTEQLLIE-------EICRGAKQQVTTGSRFNH 306
            |||.:::|.|.:  :|.......:..|.|:..:....||.       .|..|.:..:      |.
 Worm    85 AKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARIFEGLQANI------NS 143

  Fly   307 CQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLA 371
            ..|..:.||.:|.      .::|.|...|:|.|.|..:.:|::                      
 Worm   144 LDLSTAEPWQILS------YNADGYYAPHYDYLNPATNVQLVE---------------------- 180

  Fly   372 QKKLGRISRLLGLEILELDPWTGRRHGHEHITKLEHSSELKHVARLMLNLQAPGMGGAVVFPQLE 436
                ||.:|                                 :|.:::.||....||..|||:|.
 Worm   181 ----GRGNR---------------------------------IATVLVILQIAKKGGTTVFPRLN 208

  Fly   437 LAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQL 478
            |.:....|.::.|....:.|.|:.   ::..|.||:..|.::
 Worm   209 LNIRPKAGDVIVWLNTLSTGESNS---QTLHAACPIHEGTKI 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 45/238 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.