DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4ha1

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001303300.1 Gene:P4ha1 MGIID:97463 Length:534 Species:Mus musculus

Alignment Length:527 Identity:127/528 (24%)
Similarity:234/528 (44%) Gaps:77/528 (15%)


  Fly     7 VLW--LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEE 69
            ::|  |:...||.:|:|...|.....|:..|:..|..|:..|:|||:..|.:||:|::....::.
Mouse     1 MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDR 65

  Fly    70 IHS-QVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEES 133
            :.| .....|.::|:|:|.|.::||..:.|..||......:...|...|:.::...|::||...:
Mouse    66 LTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQYFPNDEDQVGA 130

  Fly   134 LNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLP 194
            ...|..||..|.||:|::|.|.:.|.:..|.::..||.|:.:    ::|:.....|:|.||.:|.
Mouse   131 AKALFRLQDTYNLDTNTISKGNLPGVQHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALTQLE 195

  Fly   195 SASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAM 259
            ....::.:        :|.:|:......|:.|:|.:||...::||.|.|.:|.........|..|
Mouse   196 EGELSTVD--------KVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLVYFEYIM 252

  Fly   260 AK-KELPKGRG-----QKSKAKKQ---ISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQL 309
            :| |:..|...     ||:..||:   :....|:...|.:|||      .::|.....|::    
Mouse   253 SKEKDANKSASGDQSDQKTAPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYH---- 313

  Fly   310 DGS-SPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDE------------EEDTKGVS 361
            ||: :|..:|.|::.|.....|.|:..||:::..|    ::::.:            :.:|..::
Mouse   314 DGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAE----IEIVKDLAKPRLSRATVHDPETGKLT 374

  Fly   362 YQSLKLSKLA----------QKKLGRISRLLGLEILELDPWTGRRHG-------HEHITKLEHSS 409
            ....::||.|          .:...||..|.||::...:......:|       |....:.:...
Mouse   375 TAQYRVSKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPD 439

  Fly   410 ELK------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ..:      .:|..:..:.....|||.|||::..:|...:|:.:.|...||.|   |.||.:..|
Mouse   440 AFRELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASG---EGDYSTRHA 501

  Fly   469 ICPVLLG 475
            .||||:|
Mouse   502 ACPVLVG 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 37/127 (29%)
P4ha1NP_001303300.1 P4Ha_N 24..153 CDD:285528 37/129 (29%)
TPR 205..238 11/33 (33%)
P4Hc 345..518 CDD:214780 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.