DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and C14E2.4

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:194 Identity:39/194 - (20%)
Similarity:77/194 - (39%) Gaps:43/194 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 RLEPVSSDPYIVLHHDVLTPKESNELLQLI-----DEEE---DTKGVSYQSLKLSK--------- 369
            |:|.:|..|.:|::.||.:.|:.::.|:|:     :|::   |...::|.:.:.:.         
 Worm    82 RMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHSH 146

  Fly   370 -LAQKKLGRISRLLGL-------EILELDPWTGRRHGH-----EHITKLEHSSELKH-------V 414
             .||..:...::||.:       :|..|....|   ||     :.:|........:|       :
 Worm   147 AEAQSLMDTATQLLPVFDFQYTEQISALSYIKG---GHYALHTDFLTFANAEDSNRHFGEMGNRL 208

  Fly   415 ARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQL 478
            |..::..:....||..:||||........|....|   |....:.|.:.:|....||:..|.::
 Worm   209 ATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLW---FNCNGNLEREAKSLHGGCPIRAGEKI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 32/176 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.