powered by:
Protein Alignment CG31371 and C14E2.4
DIOPT Version :9
| Sequence 1: | NP_733375.2 |
Gene: | CG31371 / 43626 |
FlyBaseID: | FBgn0051371 |
Length: | 507 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001359861.1 |
Gene: | C14E2.4 / 182616 |
WormBaseID: | WBGene00015773 |
Length: | 311 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 194 |
Identity: | 39/194 - (20%) |
| Similarity: | 77/194 - (39%) |
Gaps: | 43/194 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 322 RLEPVSSDPYIVLHHDVLTPKESNELLQLI-----DEEE---DTKGVSYQSLKLSK--------- 369
|:|.:|..|.:|::.||.:.|:.::.|:|: :|:: |...::|.:.:.:.
Worm 82 RMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHSH 146
Fly 370 -LAQKKLGRISRLLGL-------EILELDPWTGRRHGH-----EHITKLEHSSELKH-------V 414
.||..:...::||.: :|..|....| || :.:|........:| :
Worm 147 AEAQSLMDTATQLLPVFDFQYTEQISALSYIKG---GHYALHTDFLTFANAEDSNRHFGEMGNRL 208
Fly 415 ARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQL 478
|..::..:....||..:||||........|....| |....:.|.:.:|....||:..|.::
Worm 209 ATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLW---FNCNGNLEREAKSLHGGCPIRAGEKI 269
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG31371 | NP_733375.2 |
P4Ha_N |
30..156 |
CDD:285528 |
|
| C14E2.4 | NP_001359861.1 |
P4Hc |
100..276 |
CDD:214780 |
32/176 (18%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1591 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.