DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and phy-2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_502317.1 Gene:phy-2 WormBaseID:WBGene00004025 Length:539 Species:Caenorhabditis elegans

Alignment Length:516 Identity:130/517 (25%)
Similarity:220/517 (43%) Gaps:72/517 (14%)


  Fly    13 LFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH--SQVD 75
            |..|:..:|.|:.......||.:|..|..:...:..|||....:|:::||  .|.|.:|  :..:
 Worm     6 LVCLLAGLAHADLFTAIADLQHMLGAEKDVTTIIDQYIEAERARLDDLRR--YAHEYVHRNAHAE 68

  Fly    76 SV-EEYMGNPLNVFGILKRFESVWPGLE-----QKANATLEMVFGERLSDRQLTLPSEEDYEESL 134
            || .|::.||:|.:.::||..:.|..:|     .||:..|:.:...|:.. ::..|.|||...:.
 Worm    69 SVGPEFVTNPINAYLLIKRLTTEWKKVENIMLNNKASTFLKNITDNRVRS-EVKFPGEEDLSGAA 132

  Fly   135 NHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLPS 195
            ..||.||..|.||:..||.|::.|.|:.:.:|..|..||.|    :.|:.....|::.||.|:.:
 Worm   133 TALLRLQDTYSLDTLDLSNGIIGGEKVSNKLSGHDTFEVGRSAYNQKDYYHCLMWMQVALVKIEN 197

  Fly   196 ASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMA 260
            .:..:.|..        .|||......|:.|.:.|||:..:.|..:.|.:   .:||..::   .
 Worm   198 ENPPTIEEW--------EILEYLAYSLYQQGNVRRALSLTKRLAKIAPNH---PRAKGNVK---W 248

  Fly   261 KKELPKGRGQKSKAKKQISKS------TEQLLIEEICRGAKQQVTTGSRFN-HCQLDGSSPWLLL 318
            .:::.:|:.........::|.      .|:...|.:|||....|....:.. .|.|....|:|.|
 Worm   249 YEDMLQGKDMVGDLPPIVNKRVEYDGIVERDAYEALCRGEIPPVEPKWKNKLRCYLKRDKPFLKL 313

  Fly   319 QPSRLEPVSSDPYIVLHHDVLTPKE--------SNELLQLIDEEEDTKGVSYQSLKLSKLAQKK- 374
            .|.::|.:..||..||..:|:...|        |.:|.:...:...|..:.:.:.::||.|..| 
 Worm   314 APIKVEILRFDPLAVLFKNVIHDSEIEVIKELASPKLKRATVQNSKTGELEHATYRISKSAWLKG 378

  Fly   375 -----LGRISRLLGLEILELDPWT------------GRRHGHEHITKLEHSSELK------HVAR 416
                 :.|::|.:. :...|:..|            |....|....:.|..:..|      .:|.
 Worm   379 DLDPVIDRVNRRIE-DFTNLNQATSEELQVANYGLGGHYDPHFDFARKEEKNAFKTLNTGNRIAT 442

  Fly   417 LMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQ 477
            ::..:..|..|||.||..|..||...:...|.|......|   |.|.|:..|.|||||||:
 Worm   443 VLFYMSQPERGGATVFNHLGTAVFPSKNDALFWYNLRRDG---EGDLRTRHAACPVLLGVK 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 41/134 (31%)
phy-2NP_502317.1 P4Ha_N 21..154 CDD:285528 41/136 (30%)
TPR_16 169..240 CDD:290168 19/82 (23%)
P4Hc 335..508 CDD:214780 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146325902
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.870 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.