DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and dpy-18

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_499464.1 Gene:dpy-18 WormBaseID:WBGene00001077 Length:559 Species:Caenorhabditis elegans

Alignment Length:547 Identity:128/548 (23%)
Similarity:217/548 (40%) Gaps:124/548 (23%)


  Fly    11 LQLFLLVESVAG---ANFARGEEQLQALLDTETQLIDGLRDYI----ERLERQLEEIRRETSAIE 68
            ::|.|||.:..|   |:.......:|.||:||..:...|..||    |||. ||:::..|.|...
 Worm     1 MRLALLVLATIGYAVADLFTSIADMQNLLETERNIPKILDKYIHDEEERLV-QLKKLSEEYSKKN 64

  Fly    69 EIHSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQ--LTLPSEEDYE 131
            ||  .:::..:.:.||:|.|.::||....|..:|.|.||.........::|..  :..|:.:|..
 Worm    65 EI--SIENGLKDITNPINAFLLIKRKIFDWKEIESKMNANKAGNVVSSITDDSYGVRYPTADDLS 127

  Fly   132 ESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEK 192
            .:...||.||..|.||:..|:.|.:...:...:.|..||.|:||    :.||.....|:|.|..:
 Worm   128 GAAIGLLRLQDTYRLDTKDLADGKIYADQGNYTFSAKDCFEIARAAYNEHDFYHTVMWMEEAQRR 192

  Fly   193 LPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIE- 256
            |....|.:.|.:        .|||......|:...|..||...||   |..||....:||..:: 
 Worm   193 LGDEVEPTVEVE--------DILEYLAFALYKQNNLKHALKLTEE---LYKMNPTHPRAKGNVKW 246

  Fly   257 -----------KAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRG----AKQQVTTGSRFNH 306
                       ::..:|.||..:.::..:   :..:||:.:.|.:||.    :::.:   ||. :
 Worm   247 YEDLLEQEGVRRSDMRKNLPPIQNRRPDS---VLGNTERTMYEALCRNEVPVSQKDI---SRL-Y 304

  Fly   307 CQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLA 371
            |......|:|:..|.::|....:|..||..||::               |.:..:.|.|...|||
 Worm   305 CYYKRDRPFLVYAPIKVEIKRFNPLAVLFKDVIS---------------DDEVAAIQELAKPKLA 354

  Fly   372 QKKLG------------RISRLLGLEILELDPWTG-------RRHGHEHITKLEHSSELK----- 412
            :..:.            |||:...|:     .|.|       :|.|:....::|.:.||:     
 Worm   355 RATVHDSVTGKLVTATYRISKSAWLK-----EWEGDVVETVNKRIGYMTNLEMETAEELQIANYG 414

  Fly   413 ---------------------------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWR 450
                                       .:|.::..:..|..||..||.:.:..:...:...|.|.
 Worm   415 IGGHYDPHFDHAKKEESKSFESLGTGNRIATVLFYMSQPSHGGGTVFTEAKSTILPTKNDALFWY 479

  Fly   451 TRFAGGSSSEWDYRSGQAICPVLLGVQ 477
            ..:..|..:. |.|  .|.||||:|::
 Worm   480 NLYKQGDGNP-DTR--HAACPVLVGIK 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 40/132 (30%)
dpy-18NP_499464.1 P4Ha_N 21..152 CDD:285528 40/134 (30%)
P4Hc 338..511 CDD:214780 34/190 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.