DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and p4ha3

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_004921007.2 Gene:p4ha3 XenbaseID:XB-GENE-962355 Length:89 Species:Xenopus tropicalis

Alignment Length:66 Identity:21/67 (31%)
Similarity:30/67 (45%) Gaps:17/67 (25%)


  Fly   124 LPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSS--------------MSWGDCLEVA 174
            ||:.||.|.:...|:.||.||.|:.|.|:.|:   |:..||              ||..||..:.
 Frog    27 LPAPEDVEGAAKALMRLQDVYSLNVNGLARGM---FQRSSSSDTKLLYNPPHLSIMSADDCFHIG 88

  Fly   175 R 175
            :
 Frog    89 K 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 14/32 (44%)
p4ha3XP_004921007.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92167098
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.