DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and LOC100492280

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002936013.2 Gene:LOC100492280 ID: Length:530 Species:Xenopus tropicalis

Alignment Length:518 Identity:135/519 (26%)
Similarity:235/519 (45%) Gaps:68/519 (13%)


  Fly     7 VLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEI- 70
            ||.||.||    |.|.|:|......:..||:||..|:..|:|||:..|::|.:|::....::.: 
 Frog     6 VLPLLGLF----SCAHADFFTSIGHMTDLLNTEKDLVTSLKDYIKAEEQKLAQIKKWADKLDHLT 66

  Fly    71 HSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLN 135
            .:.....|.::|:|:|.|.::||..:.|..||......:...|...|:.::...|::||...:..
 Frog    67 DTATKDPEGFLGHPVNAFKLMKRLNTEWVKLENLILKDISDGFISNLTIQRQYFPNDEDQTGAAK 131

  Fly   136 HLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLPSA 196
            .||.||..|.||::::|.|.:.|.|..:|::..||.::.:    .:|:.....|:|.||.:|.:.
 Frog   132 ALLRLQDTYNLDTDTISKGNLPGVKHKTSLTAEDCFDLGKTAYTDADYYHTELWMEQALSQLDAG 196

  Fly   197 SENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMAK 261
            .|:|.:        :|.:|:......|:.|:|.:||...:.||.|.|.:|......|..|..|:|
 Frog   197 EESSLD--------KVMVLDYLSYAVYQQGDLDKALTLTKLLLELDPEHQRGNGNLRYFEYIMSK 253

  Fly   262 KELPKGRGQKSKAKKQISKS------TEQLLIEEICRGAKQQVTTGSRFN-HCQ-LDGS-SPWLL 317
            :...........|:....|.      .|:...|::|||...::|:..:.. .|: .||: .|.|:
 Frog   254 ESNKSSSSPSEGAELGTRKGRPKDHLPERQKYEKLCRGEGVKMTSRRQKRLFCRYFDGNKDPLLI 318

  Fly   318 LQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLGRISRLL 382
            |.|::.|.....|.||.:||:::.:|.:::.:|.........:|.....:.:.||.::.:.:.|.
 Frog   319 LSPTKQEDEWDKPRIVRYHDIISDEEISKVKELAKPRLRRATISNPITGVLETAQYRISKSAWLS 383

  Fly   383 GLEILELDPWTGRRHGH-EHITKLEHSS--ELK-------------------------------- 412
            ..|    ||...|.:.. |.:|.|:.|:  ||:                                
 Frog   384 AYE----DPVVARLNRRIEGVTGLDMSTAEELQVANYGMGGQYEPHFDFARKDEPDAFKELGTGN 444

  Fly   413 HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            .||..:..:.....|||.|||::..||...:|:.:.|...|..|   |.||.:..|.||||:|
 Frog   445 RVATWLFYMSDVEAGGATVFPEVGAAVYPKKGTAVFWYNLFESG---EGDYSTRHAACPVLVG 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/127 (28%)
LOC100492280XP_002936013.2 P4Ha_N 23..152 CDD:285528 36/129 (28%)
P4Hc 341..514 CDD:214780 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.