DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and p4ha1b

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_999856.1 Gene:p4ha1b ZFINID:ZDB-GENE-030131-4089 Length:536 Species:Danio rerio

Alignment Length:548 Identity:129/549 (23%)
Similarity:227/549 (41%) Gaps:123/549 (22%)


  Fly     9 WLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH-S 72
            |.|..||.....|..:|.....|:..||..|..|:..|::||::.|.:||:::.....::.:. :
Zfish     5 WFLLSFLFHFLYAHNDFFTSTGQMTDLLYAEKDLVTSLKEYIKQEENRLEQVKEWADKLDSLTIT 69

  Fly    73 QVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNHL 137
            .....|.::|:|:|.|.::||..|.|..||..........|...|:.::...|::||...:...|
Zfish    70 ATQDPEGFLGHPVNAFKLMKRLNSEWSDLENLVLKDTTNGFISNLTVQRQYFPTDEDQTGAAKAL 134

  Fly   138 LHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLPSASE 198
            |.||..|:|.:|::|.|.:.|....|.|:..||.|:.:    .:|:.....|:..||.:|....|
Zfish   135 LRLQDTYQLSANAISSGDLPGVVHKSRMTVEDCYELGKIAYSDADYYHTELWMAQALSQLDEGEE 199

  Fly   199 NSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMN--------------QGIQ 249
            :..:        :|.:::......|:.|||.|||...:.:|.|.|.:              :..:
Zfish   200 SPID--------KVTVMDYLSYAIYQQGELDRALELTKRMLKLDPNHHRANGNLKYFEFQLEKQR 256

  Fly   250 KAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQ 308
            ||:.:.::...|:.|.|...|:.::|..:   .|:...|.:|||      .::|.....|:::  
Zfish   257 KAENEKKEEDQKRVLDKRDAQRKRSKDPL---PERKKYERLCRGEGIKLTPRRQSRLFCRYSN-- 316

  Fly   309 LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQK 373
             :..:|.|||.|.:.|.....|.||.:|::::           |.|.:|         :.::|:.
Zfish   317 -NNRNPRLLLAPVKQEDEWDRPRIVRYHEIIS-----------DSEIET---------VKEMAKP 360

  Fly   374 KLGR--ISR-LLGLEILELDP-------WTGRRHGHEHIT--------------KLEHSSELK-- 412
            :|.|  ||. :.|  :||..|       |..   |:||.|              :::.:.||:  
Zfish   361 RLRRATISNPITG--VLETAPYRISKSAWLS---GYEHSTIERINQRIEDVTGLEMDTAEELQVA 420

  Fly   413 ------------------------------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLL 447
                                          .:|..:..:.....|||.||..:..||...:|:.:
Zfish   421 NYGVGGQYEPHFDFGRKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFTDVGAAVWPKKGTAV 485

  Fly   448 HWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            .|...|..|   |.||.:..|.||||:|
Zfish   486 FWYNLFPSG---EGDYSTRHAACPVLVG 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/127 (28%)
p4ha1bNP_999856.1 P4Ha_N 24..153 CDD:285528 36/129 (28%)
TPR repeat 164..199 CDD:276809 8/35 (23%)
TPR_16 168..238 CDD:290168 18/78 (23%)
TPR repeat 204..234 CDD:276809 9/30 (30%)
P4Hc 347..520 CDD:214780 40/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.