DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and AT1G07380

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001321129.1 Gene:AT1G07380 AraportID:AT1G07380 Length:780 Species:Arabidopsis thaliana

Alignment Length:770 Identity:303/771 (39%)
Similarity:420/771 (54%) Gaps:81/771 (11%)


  Fly     7 AFLAFLAVSFLC---GLVS-ATYKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVV 67
            :|.....|.||.   |:.| :.|.:|:|..|||||..::|.|||||::||..|||.|:.||.|:|
plant    16 SFFYISTVLFLLTGGGVYSHSEYLIGLGSYDITGPAADVNMMGYANMEQVASGIHFRLRARTFIV 80

  Fly    68 EDEKGNRVAFVSADAGMMGYGLKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDI 132
            .:.:|.||.||:.||.|....:|.:||:||:||||::|...||.|||.|||..|||:|.:::|.:
plant    81 SEPQGKRVVFVNLDACMASQIVKLKVIERLKARYGDLYTEQNVGISGIHTHAGPGGYLQYVVYIV 145

  Fly   133 SILGFVPQTFEVMAQGLYLCIKRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEH 197
            :.||||.|:|:.:..|:...|.:|.:||..|.|.|:...:|:..:|||||:||.||::||:::::
plant   146 TSLGFVRQSFDALVDGIENSIIQAHENLRPGSIFLNNGELLDAGVNRSPSAYLNNPSKERSKHKY 210

  Fly   198 DTDKTLTQLRFVDLENNLLGAFNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPN------- 255
            :.||.:|.|:|||.:...:|:|||:|.|.|||:.||.|::.||.|.|:..:|..|..|       
plant   211 NVDKEMTLLKFVDDQWGPVGSFNWFATHGTSMSRTNSLISGDNKGAASRFMEDWYEQNTAERSYS 275

  Fly   256 ----------------------------------KMPG---------------------KGKFVG 265
                                              ..||                     |..||.
plant   276 EEFISDEIPRRVSSLIENHQDSHHELLELASYFESQPGKPVTRISSSARRVRSALRKADKPGFVS 340

  Fly   266 AFCSSNLGDVSPNIMGPKCSISGNECDLLTSRCPTGEGDCFASGPG-KDMFESTQILGQRLADAA 329
            |||.:|.||||||::|..|..:|..||...|.|......|:..||| .|.||||:|:|:|....|
plant   341 AFCQTNCGDVSPNVLGAFCLDTGLPCDFNHSTCGGKNEMCYGRGPGYPDEFESTRIIGERQFKMA 405

  Fly   330 LGLLNEQSQESTAREVTGDVRFIHQFVDMPNYNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDG 394
            |.|.|:.|:     ::.|.|.:.|.:||....| .|......|.:.::.|..|||::||||||||
plant   406 LELFNKASE-----QLQGKVDYRHVYVDFSQLN-VTLPKKDGKSEVVKTCPAAMGFAFAAGTTDG 464

  Fly   395 PGAFSFEQGTTTDNPMWNFVRDFIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKI 459
            ||||.|.||....||.|..||:.:..|.::.|.||.||||||.||..|.||:|.|.|:|.|:|:|
plant   465 PGAFDFTQGDDKGNPFWRLVRNVLKTPDKKQIDCHYPKPILLDTGEMTKPYDWAPSILSLQVLRI 529

  Fly   460 GDVIIAAVPCEFTTMAGRRLRNQIRAAASAVGGID----TEVIIAGLTNIYTSYTVTPEEYQAQR 520
            |.:.|.:||.|||||||||||..::......|..|    ..|:||||.|.|:.|..|.||||.||
plant   530 GQLFILSVPGEFTTMAGRRLRYAVKTQLKNSGNKDLSGEIHVVIAGLANGYSQYVTTFEEYQVQR 594

  Fly   521 YEAASTIFGPHTHSIYMDVFERLTKAMMRNETVDAGPSPPYMNDVMLSLNTGVLFDGHPINTDFG 585
            ||.|||::||||.|.|:..|::|:|:::.:..|..||.||.:.|..||..|.|:.|..|....||
plant   595 YEGASTLYGPHTLSGYIQEFKKLSKSLVLDMPVQPGPQPPDLLDKQLSFLTPVMMDTTPSGDSFG 659

  Fly   586 YVKSQPNKEYGI---NETVKVTYISGNPRNNLFTEKTYFTIERKINEDR-WKVAYTDASWETKMV 646
            .|.|...|...:   |..|.|.:.|..|||:|.||.|:..:||...:|: |...|.|.....:..
plant   660 DVISDVPKNLSLKRGNGQVTVVFRSACPRNDLLTEGTFTLVERLEQKDKTWTPVYDDDDLCLRFK 724

  Fly   647 WHRTNTILGFSEMDIYWDISPQTLPGEYRIRHSGEYKYILGGKYPYEGLTHSFTV 701
            |.|...:...|:..:.|.|.....||.|||.|.|..|.:.|..:.:.|.:.:|.|
plant   725 WSRHKKLSSRSQATVEWRIPESASPGVYRITHFGAAKKLFGSVHHFTGSSSAFVV 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 296/748 (40%)
Ceramidase_alk 25..538 CDD:282576 243/580 (42%)
Ceramidse_alk_C 540..701 CDD:293653 53/165 (32%)
AT1G07380NP_001321129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I290
OMA 1 1.010
OrthoDB 1 1.010 D967085at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 LDO PTHR12670
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.