DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and AT5G58980

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_200706.1 Gene:AT5G58980 AraportID:AT5G58980 Length:733 Species:Arabidopsis thaliana

Alignment Length:732 Identity:287/733 (39%)
Similarity:407/733 (56%) Gaps:50/733 (7%)


  Fly     8 FLAFLAVSFLCGLVSATYKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKG 72
            ||.|| :...|....:.|.:|:|..|||||..::|.|||||::||..|:|.|:.||||:|.:...
plant    13 FLLFL-LRLTCIFSDSDYLMGLGSYDITGPAADVNMMGYANMEQVASGVHFRLRARAFIVAEPYK 76

  Fly    73 NRVAFVSADAGMMGYGLKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGF 137
            .|:|||:.||||....:..:||:||:.|||.:|..:||||||||||..|||:|.::||.::.|||
plant    77 KRIAFVNLDAGMASQLVTIKVIERLKQRYGELYTEENVAISGTHTHAGPGGYLQYILYLVTSLGF 141

  Fly   138 VPQTFEVMAQGLYLCIKRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKT 202
            |.|:|..:..|:...|.:|.:||..|.||::|..:|:..:|||||:||.|||.||::||:|.||.
plant   142 VHQSFNALVDGIEQSIIQAHENLRPGSILINKGELLDAGVNRSPSAYLNNPAHERSKYEYDVDKE 206

  Fly   203 LTQLRFVDLENNLLGAF--NWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKM-------- 257
            :|.::|||.:...:...  :|:     ...|..|.|..::....:.::...|:.:.|        
plant   207 MTLVKFVDDQWGPVARIMEDWF-----ERENGCRSVDVESPRRVSSIISDPYDQDLMEMASSLLS 266

  Fly   258 ----------------------PGKGKFVGAFCSSNLGDVSPNIMGPKCSISGNECDLLTSRCPT 300
                                  ..|.:||.|||.:|.||||||::|..|..:|..|:...|.|..
plant   267 TGGKTVTRMSSVARRVRSRFRHADKPRFVSAFCQTNCGDVSPNVLGAFCIDTGLPCEFNQSTCGG 331

  Fly   301 GEGDCFASGPG-KDMFESTQILGQRLADAALGLLNEQSQESTAREVTGDVRFIHQFVDMPNYNGS 364
            ....|:..||| .|.||||:|:|:|....|..|..:.|:     |:.|.|.:.|.:||..... .
plant   332 KNEQCYGRGPGYPDEFESTRIIGERQFKKAADLFTKASE-----EIQGKVDYRHAYVDFSQLE-V 390

  Fly   365 TYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPMWNFVRDFIAAPTQEDIKCH 429
            |.|..:...:.::.|..|||:.||||||||||||.|:||....||.|..||:.:..||:|.::|.
plant   391 TINGQNGGSEVVKTCPAAMGFGFAAGTTDGPGAFDFKQGDDQGNPFWRLVRNLLKNPTEEQVRCQ 455

  Fly   430 EPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTMAGRRLRNQIRAA-ASAVGGI 493
            .||||||.||....||:|.|.|:..|:|:||.::|..||.|||||||||||:.::.. .....|.
plant   456 RPKPILLDTGEMKQPYDWAPSILPVQILRIGQLVILCVPGEFTTMAGRRLRDAVKTVLKEGSNGR 520

  Fly   494 DTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMDVFERLTKAMMRNETVDAGPS 558
            :..|:||||||.|:.|..|.||||.||||.|||::||||.|.|:..|::|...::..:|.|.||.
plant   521 EFSVVIAGLTNSYSQYIATFEEYQVQRYEGASTLYGPHTLSGYIQEFKKLANDLLSAQTTDPGPQ 585

  Fly   559 PPYMNDVMLSLNTGVLFDGHPINTDFGYVKS---QPNKEYGINETVKVTYISGNPRNNLFTEKTY 620
            ||.:....:||.|.|:.|..||.|.||.|.|   :.:|.....:.|:|.:.|.||||:|.||.|:
plant   586 PPDLLHKQISLLTPVVADMTPIGTAFGDVTSDVPRLSKFRKGADIVRVQFRSANPRNDLMTEGTF 650

  Fly   621 FTIERKI-NEDRWKVAYTDASWETKMVWHRTNTILGFSEMDIYWDISPQTLPGEYRIRHSGEYKY 684
            ..:||.: ..:.|...|.|..:..:..|.|...:...|...|.|.|.....||.|||.|.|..|.
plant   651 ALVERWLEGRETWVPVYDDDDFCLRFKWSRPFKLSTQSTATIEWRIPETASPGVYRITHFGSAKT 715

  Fly   685 ILGGKYPYEGLTHSFTV 701
            .:...:.:.|.:.:|.|
plant   716 PISSIHHFSGSSSAFVV 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 281/715 (39%)
Ceramidase_alk 25..538 CDD:282576 228/547 (42%)
Ceramidse_alk_C 540..701 CDD:293653 53/165 (32%)
AT5G58980NP_200706.1 Ceramidase_alk 29..565 CDD:309742 228/547 (42%)
Ceramidse_alk_C 567..732 CDD:319107 53/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I290
OMA 1 1.010
OrthoDB 1 1.010 D967085at2759
OrthoInspector 1 1.000 T125168
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 O PTHR12670
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.