DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and AT2G38010

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_973628.1 Gene:AT2G38010 AraportID:AT2G38010 Length:792 Species:Arabidopsis thaliana

Alignment Length:798 Identity:293/799 (37%)
Similarity:423/799 (53%) Gaps:120/799 (15%)


  Fly     8 FLAFLAVSFLCGLVSATYKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKG 72
            |:.||.:..|...|.| |.:|||..|||||..::|.|||||..|:..|||.|:.||||:|.:.:|
plant    10 FILFLLLLLLSRTVYA-YLIGVGSYDITGPAADVNMMGYANSDQIASGIHFRLRARAFIVAEPQG 73

  Fly    73 NRVAFVSADAGMMGYGLKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGF 137
            |||.||:.||.|....:..:|::||:||||.:|...||||||.|||..|||:|.::.|.::.|||
plant    74 NRVVFVNLDACMASQIVTIKVLERLKARYGELYTEKNVAISGIHTHAGPGGYLQYVTYIVTSLGF 138

  Fly   138 VPQTFEVMAQGLYLCIKRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKT 202
            |.|:|:|:..|:...|.:|.::|..|...::|..:|:..:||||||||.|||.||::|::|.||.
plant   139 VRQSFDVVVNGIEQSIVQAHESLRPGSAFVNKGDLLDAGVNRSPSSYLNNPAAERSKYKYDVDKE 203

  Fly   203 LTQLRFVDLENNLLGAFNWYAVHATSMNNTNRLVTSDNVGYAALLLE------------------ 249
            :|.::|||.:....|:|||:|.|.|||:.||.|::.||.|.||..:|                  
plant   204 MTLVKFVDSQLGPTGSFNWFATHGTSMSRTNSLISGDNKGAAARFMEDWFENGQKNSVSSRNIPR 268

  Fly   250 ------KEYNPNK-------MP------------------------------------------- 258
                  .:::.|:       :|                                           
plant   269 RVSTIVSDFSRNRESYPFLELPNVAILYIAVAERLMWKVMVLFYFVSESRLLDIAATYKSSRGHS 333

  Fly   259 --------------GKGKFVGAFCSSNLGDVSPNIMGPKCSISGNECDLLTSRCPTGEGD-CFAS 308
                          .|.|||.|||.||.||||||.:|..|..:|..||...|.| .|:.: |:..
plant   334 VDKSLDVKTRVRNGSKRKFVSAFCQSNCGDVSPNTLGTFCIDTGLPCDFNHSTC-NGQNELCYGR 397

  Fly   309 GPG-KDMFESTQILGQRLADAALGLLNEQSQESTAREVTGDVRFIHQFVDMPNYN--------GS 364
            ||| .|.||||:|:|::....|:.|.|:.::     ::.|.:.:.|.::|..|.:        ||
plant   398 GPGYPDEFESTRIIGEKQFKMAVELFNKATE-----KLQGKIGYQHAYLDFSNLDVTVPKAGGGS 457

  Fly   365 TYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPMWNFVRDFIAAPTQEDIKCH 429
                     :.::.|..|||:.||||||||||||.|:||....|..|..||:.:..|..|.::|.
plant   458 ---------ETVKTCPAAMGFGFAAGTTDGPGAFDFKQGDDQGNVFWRLVRNVLRTPGPEQVQCQ 513

  Fly   430 EPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTMAGRRLRNQIRAAASAVG--- 491
            :||||||.||....||:|.|.|:..|:|:||.::|.:||.|||||||||||:.|::...:..   
plant   514 KPKPILLDTGEMKEPYDWAPSILPIQILRIGQLVILSVPGEFTTMAGRRLRDAIKSFLISSDPKE 578

  Fly   492 -GIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMDVFERLTKAMMRNETVDA 555
             ..:..|:||||||.|:.|..|.|||:.||||.|||::|.||.:.|:..|::|..|::...|:..
plant   579 FSNNMHVVIAGLTNTYSQYIATFEEYEVQRYEGASTLYGRHTLTAYIQEFKKLATALVNGLTLPR 643

  Fly   556 GPSPPYMNDVMLSLNTGVLFDGHPINTDFGYVKSQ--PNKEYGINETVKVTYISGNPRNNLFTEK 618
            ||.||.:.|..:||.:.|:.|..|:...||.||:.  |...:...:.|..|:.||.|||:|.||.
plant   644 GPQPPDLLDKQISLLSPVVVDSTPLGVKFGDVKADVPPKSTFRRGQQVNATFWSGCPRNDLMTEG 708

  Fly   619 TYFTIERKINEDRWKVAYTDASWETKMVWHRTNTILGFSEMDIYWDISPQTLPGEYRIRHSGEYK 683
            ::..:|......:|...|.|..:..|..|.|...:...|:..|.|.:....:.|.|||||.|..|
plant   709 SFAVVETLREGGKWAPVYDDDDFSLKFKWSRPAKLSSESQATIEWRVPESAVAGVYRIRHYGASK 773

  Fly   684 YILGGKYPYEGLTHSFTV 701
            .:.|....:.|.:.:|.|
plant   774 SLFGSISSFSGSSSAFVV 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 286/781 (37%)
Ceramidase_alk 25..538 CDD:282576 236/615 (38%)
Ceramidse_alk_C 540..701 CDD:293653 50/163 (31%)
AT2G38010NP_973628.1 PTZ00487 26..773 CDD:240437 282/762 (37%)
Ceramidase_alk 26..626 CDD:282576 236/615 (38%)
Ceramidse_alk_C 628..775 CDD:293653 47/147 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10310
Inparanoid 1 1.050 514 1.000 Inparanoid score I290
OMA 1 1.010
OrthoDB 1 1.010 D967085at2759
OrthoInspector 1 1.000 T125168
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 O PTHR12670
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.