DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and ASAH2

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_063946.2 Gene:ASAH2 HGNCID:18860 Length:780 Species:Homo sapiens

Alignment Length:697 Identity:307/698 (44%)
Similarity:425/698 (61%) Gaps:41/698 (6%)


  Fly    25 YKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKG-NRVAFVSADAGMMGYG 88
            |.:||||||.||...:||.|||....|..:||.||:::|||::.:..| ||..|||.|.||:...
Human   102 YHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQR 166

  Fly    89 LKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCI 153
            |:.||:.|||::||::|..|||.:||||||..|.|:..:.::.|:..||..|||:.|..|:...|
Human   167 LRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSI 231

  Fly   154 KRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGA 218
            ..|..|:..|:|.::|..|..|.|||||.|||:||..|||:|..:|||.:..|:.|||..:.||.
Human   232 DIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGL 296

  Fly   219 FNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGPK 283
            .:|:|:|..||||:|.||.|||||||:.|||:|.|...:||:|.||.||.|||||||||||:||:
Human   297 ISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGPFVAAFASSNLGDVSPNILGPR 361

  Fly   284 CSISGNECDLLTSRCPT-GEGDCFASGPGKDMFESTQILGQRLADAALGLLNEQSQESTAREVTG 347
            |..:|..||...|.||. |...|.|.|||:|||:||||:|:.:...|     ::...|.::||||
Human   362 CINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRA-----KELYASASQEVTG 421

  Fly   348 DVRFIHQFVDMPN---YNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNP 409
            .:...||:|||.:   :..||:        ..:.|:||:||||||||.||.|..:|.||.|..:|
Human   422 PLASAHQWVDMTDVTVWLNSTH--------ASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDP 478

  Fly   410 MWNFVRDFIAAPTQEDIK-CHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTT 473
            .|:.:||.|.....|:|| ||:||||||.||..:.|:.|.|.||..|::.:|.:.|.|:|.||||
Human   479 FWDTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTT 543

  Fly   474 MAGRRLRNQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMD 538
            |:|||||..::|..::.|..:..|:|:||.|:||.|..|.||||||||||||||:||||.|.|:.
Human   544 MSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTHYITTYEEYQAQRYEAASTIYGPHTLSAYIQ 608

  Fly   539 VFERLTKAMMRNETV---DAGPSPPYMNDVMLSLNTGVLFDGHPINTDFGYVKSQPNKEYGINET 600
            :|..|.|| :..:||   ..||.||:...:::.|...:: |..|....||.|......||.:.|.
Human   609 LFRNLAKA-IATDTVANLSRGPEPPFFKQLIVPLIPSIV-DRAPKGRTFGDVLQPAKPEYRVGEV 671

  Fly   601 VKVTYISGNPRNNL--FTEKTYFTIER-KINEDRWKVAYTDASWETKMVWHRTNTILGFSEMDIY 662
            .:|.::..||:|::  .|.:|:.|:|: :.....|::...||||||:..||:  .:||.|...:.
Human   672 AEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHK--GLLGLSNATVE 734

  Fly   663 WDISPQTLPGEYRIRHSGEYK--------YILGGKYPYEGLTHSFTV 701
            |.|.....||.||||:.|..:        .||.    :||.:.:|.|
Human   735 WHIPDTAQPGIYRIRYFGHNRKQDILKPAVILS----FEGTSPAFEV 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 306/696 (44%)
Ceramidase_alk 25..538 CDD:282576 253/519 (49%)
Ceramidse_alk_C 540..701 CDD:293653 53/175 (30%)
ASAH2NP_063946.2 PTZ00487 100..778 CDD:240437 307/698 (44%)
Ceramidase_alk 102..608 CDD:282576 253/519 (49%)
Ceramidse_alk_C 610..777 CDD:293653 53/175 (30%)
Required for correct folding and localization. {ECO:0000250|UniProtKB:Q91XT9} 770..780 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256963350
eggNOG 1 0.900 E1_KOG2232
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10310
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6313
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 LDO PTHR12670
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.