DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and Asah2

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_061300.1 Gene:Asah2 MGIID:1859310 Length:756 Species:Mus musculus

Alignment Length:702 Identity:313/703 (45%)
Similarity:429/703 (61%) Gaps:51/703 (7%)


  Fly    25 YKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKG-NRVAFVSADAGMMGYG 88
            |.:||||||.||...:||.|||....|..||:.||:|:|||::.|..| ||:||||.:..|:...
Mouse    78 YYIGVGRADCTGQVSDINLMGYGKNGQNARGLLTRLFSRAFILADPDGSNRMAFVSVELCMISQR 142

  Fly    89 LKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCI 153
            |:.||:|||:::||::|..|||.:|..|||..|.||..:.||.::..||..:||:.:..|:...|
Mouse   143 LRLEVLKRLESKYGSLYRRDNVILSAIHTHSGPAGFFQYTLYILASEGFSNRTFQYIVSGIMKSI 207

  Fly   154 KRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGA 218
            ..|..||..|:|.::|..|.||.|||||||||.||..|||:|..:|||.:..|:.|||....||.
Mouse   208 DIAHTNLKPGKIFINKGNVANVQINRSPSSYLLNPQSERARYSSNTDKEMLVLKLVDLNGEDLGL 272

  Fly   219 FNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGPK 283
            .:|:|:|..||||:|..|.|||:||||.|.|:|.|...:||:|.||..|.|||||||||||:||.
Mouse   273 ISWFAIHPVSMNNSNHFVNSDNMGYAAYLFEQEKNKGYLPGQGPFVAGFASSNLGDVSPNILGPH 337

  Fly   284 CSISGNECDLLTSRCPT-GEGDCFASGPGKDMFESTQILGQRLADAALGLLNEQSQE---STARE 344
            |..:|..||...|.||. |...|.|||||:||||||.|:|:        ::.::::|   |.::|
Mouse   338 CVNTGESCDNDKSTCPNGGPSMCMASGPGQDMFESTHIIGR--------IIYQKAKELYASASQE 394

  Fly   345 VTGDVRFIHQFVDMPNYN---GSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTT 406
            |||.|...||:|:|.:.:   .:|:.        ::.|:||:||||||||.||....:..||||.
Mouse   395 VTGPVLAAHQWVNMTDVSVQLNATHT--------VKTCKPALGYSFAAGTIDGVSGLNITQGTTE 451

  Fly   407 DNPMWNFVRD-FIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCE 470
            .:|.|:.:|| .:..|::|.::|.:||||||.:|..|.|:.|||.||..|::.:|.:.|||:|.|
Mouse   452 GDPFWDTLRDQLLGKPSEEIVECQKPKPILLHSGELTIPHPWQPDIVDVQIVTVGSLAIAAIPGE 516

  Fly   471 FTTMAGRRLRNQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSI 535
            .|||:|||.|..|:...:..|..|..|:||||:|:||.|..|.||||||||||||||:||||.|.
Mouse   517 LTTMSGRRFREAIKKEFALYGMKDMTVVIAGLSNVYTHYITTYEEYQAQRYEAASTIYGPHTLSA 581

  Fly   536 YMDVFERLTKAMMRNETV---DAGPSPPYMNDVMLSLNTGVLFDGHPINTDFGYVKSQPNKEYGI 597
            |:.:|..|.|| :..:||   .:||.||:..:::.||...:. |..||...||.|......||.:
Mouse   582 YIQLFRDLAKA-IATDTVANMSSGPEPPFFKNLIASLIPNIA-DRAPIGKHFGDVLQPAKPEYRV 644

  Fly   598 NETVKVTYISGNPRNNL--FTEKTYFTIERKINEDR---WKVAYTDASWETKMVWHRTNTILGFS 657
            .|.|:|.::..||:|:.  .|.:|:.|:|:  .||.   |::.|.||||||:..||:  .|||.|
Mouse   645 GEVVEVIFVGANPKNSAENQTHQTFLTVEK--YEDSVADWQIMYNDASWETRFYWHK--GILGLS 705

  Fly   658 EMDIYWDISPQTLPGEYRIRHSGEYK--------YILGGKYPYEGLTHSFTV 701
            ...|||.|.....||.||||:.|..:        .||.    :||::..|.|
Mouse   706 NATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILA----FEGISSPFEV 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 312/701 (45%)
Ceramidase_alk 25..538 CDD:282576 250/522 (48%)
Ceramidse_alk_C 540..701 CDD:293653 62/177 (35%)
Asah2NP_061300.1 PTZ00487 76..754 CDD:240437 313/703 (45%)
Ceramidase_alk 78..584 CDD:282576 250/522 (48%)
Ceramidse_alk_C 586..753 CDD:293653 62/177 (35%)
Required for correct folding and localization. {ECO:0000250|UniProtKB:Q91XT9} 746..756 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256960953
eggNOG 1 0.900 E1_KOG2232
Hieranoid 1 1.000
Homologene 1 1.000 H10310
Inparanoid 1 1.050 573 1.000 Inparanoid score I1041
Isobase 1 0.950 0 Normalized mean entropy S6313
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 1 1.000 T1083784
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 LDO PTHR12670
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4679
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.