DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and asah2

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001007764.1 Gene:asah2 ZFINID:ZDB-GENE-041112-1 Length:743 Species:Danio rerio

Alignment Length:695 Identity:302/696 (43%)
Similarity:419/696 (60%) Gaps:37/696 (5%)


  Fly    25 YKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKGN-RVAFVSADAGMMGYG 88
            |.:||||||.|||..::..|||||..|..||:|||:|:|||:|:|  || ||.||::|.||:...
Zfish    61 YLIGVGRADCTGPVADLPMMGYANTDQTARGLHTRLFSRAFIVDD--GNKRVVFVTSDIGMVSQR 123

  Fly    89 LKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCI 153
            |:.||.:.|:.:||::|..|||.:||||||...||:..:.|:.|:..|::..:.:.:..|:...|
Zfish   124 LRLEVFQALKEKYGDLYRQDNVVLSGTHTHSGVGGYFQYTLFMITSKGYIKPSIQAIVSGIVKSI 188

  Fly   154 KRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGA 218
            ..|..||..|||.::|..|.:.|.||||.||:.||.|||.:||.:|||.:..|:|.||:.:.:|.
Zfish   189 DIAHRNLRPGRIFINKGQVADSNFNRSPHSYMNNPEEERNRYEFNTDKQIVVLKFTDLDGDGIGL 253

  Fly   219 FNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPG-KGKFVGAFCSSNLGDVSPNIMGP 282
            .:|:|||..|||.|||:|:|||:|||:.:.|:|.|...:|| ||.||..|.||||||.||||.||
Zfish   254 LSWFAVHPVSMNYTNRMVSSDNLGYASYIFEQEKNIGFLPGEKGPFVAGFSSSNLGDSSPNIRGP 318

  Fly   283 KCSISGNECDLLTSRCPT-GEGDCFASGPGKDMFESTQILGQRLADAALGLLNEQSQESTAREVT 346
            .|..:|.:||.:.|.||. |:..|.|.|||:||||||:|:|:.:...|..|..     |..:|:.
Zfish   319 VCVNTGLKCDYINSSCPVGGKKACIAFGPGEDMFESTRIIGENMFKIAKELYG-----SAKQELH 378

  Fly   347 GDVRFIHQFVDMPN----YNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTD 407
            |.|...||:|:|.:    :| ||:..        |.|:||:|:|||||||||.|.|:|.||.|..
Zfish   379 GPVYGAHQWVNMTDETVQFN-STHTG--------RTCKPALGHSFAAGTTDGGGEFNFLQGDTEG 434

  Fly   408 NPMWNFVRDFIAAPTQEDIK-CHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEF 471
            :|.|:.:||.:..|...:.| ||:|||||.:||....|..|.|.||..|::.||.:.:.|||.||
Zfish   435 DPFWDGIRDAVLGPPSNETKACHQPKPILFSTGEMDSPLPWHPAIVDVQIITIGSLAVVAVPGEF 499

  Fly   472 TTMAGRRLRNQIRAAASAVGGI-DTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSI 535
            |||:|||:|..::......... :.||::|||.||||.|..|.||||.||||.|||||||||.|.
Zfish   500 TTMSGRRIREAVKRELEVKEPFTNAEVVVAGLCNIYTHYITTYEEYQIQRYEGASTIFGPHTLSA 564

  Fly   536 YMDVFERLTKAMMRNE--TVDAGPSPPYMN-DVMLSLNTGVLFDGHPINTDFGYVKSQPNKEYGI 597
            |:..:..|.||:....  .:..||.||:.: |.:.:.....:.|..|:.|.||.|..:.|..|.:
Zfish   565 YIQRYRGLAKAIAHGTIGELPKGPEPPFFDEDKLFNQVRDPVADVAPVGTTFGDVLQEVNPVYKV 629

  Fly   598 NETVKVTYISGNPRNN-LFTEKTYFTIERKINE-DRWKVAYTDASWETKMVWHRTNTILGFSEMD 660
            .|...||::|||||:: ...:.|..|:||..|: ..|::.:.||||||:..|  ...:.|.|:..
Zfish   630 GEIASVTFVSGNPRHSGDIRDTTLVTVERFHNDTGSWEIIHNDASWETRFHW--IKGLAGRSQAK 692

  Fly   661 IYWDISPQTL-PGEYRIRHSGEYKYILGGK---YPYEGLTHSFTV 701
            :.|.| |||. .|.|:|::.|.||......   .||.|.:.:|.|
Zfish   693 VEWHI-PQTAQAGTYQIQYFGHYKQTTENTTVITPYVGTSAAFKV 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 301/694 (43%)
Ceramidase_alk 25..538 CDD:282576 247/522 (47%)
Ceramidse_alk_C 540..701 CDD:293653 54/170 (32%)
asah2NP_001007764.1 PTZ00487 61..736 CDD:240437 301/694 (43%)
Ceramidase_alk 61..567 CDD:282576 247/522 (47%)
Ceramidse_alk_C 569..736 CDD:293653 54/170 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256960281
eggNOG 1 0.900 E1_KOG2232
Hieranoid 1 1.000
Homologene 1 1.000 H10310
Inparanoid 1 1.050 543 1.000 Inparanoid score I1118
OMA 1 1.010
OrthoDB 1 1.010 D118111at33208
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 1 1.000 T1053002
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 LDO PTHR12670
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4679
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.