DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and Asah2

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_446098.1 Gene:Asah2 RGDID:69410 Length:761 Species:Rattus norvegicus

Alignment Length:699 Identity:315/700 (45%)
Similarity:432/700 (62%) Gaps:45/700 (6%)


  Fly    25 YKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKG-NRVAFVSADAGMMGYG 88
            |.:||||||.||...:||.|||....|..:|:.||:|:|||::.|..| ||:||||.:..|:...
  Rat    83 YYIGVGRADCTGQVSDINLMGYGKNGQNAQGLLTRLFSRAFILADPDGSNRMAFVSVELCMISQR 147

  Fly    89 LKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCI 153
            |:.||:||||::||::|..|||.:|.||||..|.||..:.||.::..||..:||:.:..|:...|
  Rat   148 LRLEVLKRLQSKYGSLYRRDNVILSATHTHSGPAGFFQYTLYILASEGFSNRTFQYIVSGIVKSI 212

  Fly   154 KRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGA 218
            ..|..||..|::|::|..|.||.|||||||||:||..|||:|..||||.:..|:.|||....||.
  Rat   213 DIAHTNLKPGKVLINKGNVANVQINRSPSSYLQNPPSERARYSSDTDKEMVVLKLVDLNGEDLGL 277

  Fly   219 FNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGPK 283
            .:|:|||..||||:|.||.|||:||||.|.|:|.|...:||:|.||..|.|||||||||||:||.
  Rat   278 ISWFAVHPVSMNNSNHLVNSDNMGYAAYLFEQEKNRGYLPGQGPFVAGFASSNLGDVSPNILGPH 342

  Fly   284 CSISGNECDLLTSRCPT-GEGDCFASGPGKDMFESTQILGQRLADAALGLLNEQSQESTAREVTG 347
            |..:|..||...|.||: |...|.|||||:||||||.|:|:.:...|     ::...|.::||||
  Rat   343 CVNTGESCDNDKSTCPSGGPSMCMASGPGQDMFESTHIIGRVIYQKA-----KELHASASQEVTG 402

  Fly   348 DVRFIHQFVDMPNYN---GSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNP 409
            .|...||:|:|.:.:   .:|:.        ::.|:.|:||||||||.||....:..||||..|.
  Rat   403 PVLTAHQWVNMTDVSVQLNATHT--------VKTCKAALGYSFAAGTIDGVSGLNITQGTTEGNL 459

  Fly   410 MWNFVRD-FIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTT 473
            .|:.:|| .:..|::|.|:|.:|||||:.||..|.|:.|||.||..|::.:|.:.|||:|.||||
  Rat   460 FWDTLRDQLLGKPSEEIIECQKPKPILIHTGELTKPHPWQPDIVDIQIVTLGSLAIAAIPGEFTT 524

  Fly   474 MAGRRLRNQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMD 538
            |:|||||..::...:..|..|..|:||||:|:||.|..|.||||||||||||||:||||.|.|:.
  Rat   525 MSGRRLREAVKKEFALYGMKDMTVVIAGLSNVYTHYITTYEEYQAQRYEAASTIYGPHTLSAYIQ 589

  Fly   539 VFERLTKAMMRNETV---DAGPSPPYMNDVMLSLNTGVLFDGHPINTDFGYVKSQPNKEYGINET 600
            :|..|.|| :..:||   .:||.||:..:::.||...:. |..||...||.|......||.:.|.
  Rat   590 LFRALAKA-IATDTVANMSSGPEPPFFKNLIGSLIPNIA-DRAPIGKQFGDVLQPAKPEYRVGEV 652

  Fly   601 VKVTYISGNPRNNL--FTEKTYFTIERKINED---RWKVAYTDASWETKMVWHRTNTILGFSEMD 660
            |:|.::..||:|:.  .|.:|:.|:|:  .||   .|::.:.||||||:..||:  .:||.|...
  Rat   653 VEVVFVGANPKNSAENQTHQTFLTVEK--YEDSVANWQIMHNDASWETRFYWHK--GVLGLSNAT 713

  Fly   661 IYWDISPQTLPGEYRIRHSGEYK--------YILGGKYPYEGLTHSFTV 701
            |:|.|....|||.||||:.|..:        .||.    :||::..|.:
  Rat   714 IHWHIPDTALPGVYRIRYFGHNRKQELLKPAVILA----FEGISSPFEI 758

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 315/698 (45%)
Ceramidase_alk 25..538 CDD:282576 255/519 (49%)
Ceramidse_alk_C 540..701 CDD:293653 60/177 (34%)
Asah2NP_446098.1 PTZ00487 81..759 CDD:240437 315/700 (45%)
Ceramidase_alk 83..589 CDD:282576 255/519 (49%)
Ceramidse_alk_C 591..758 CDD:293653 60/177 (34%)
Required for correct folding and localization. {ECO:0000269|PubMed:15123644} 751..761 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256965005
eggNOG 1 0.900 E1_KOG2232
Hieranoid 1 1.000
Homologene 1 1.000 H10310
Inparanoid 1 1.050 580 1.000 Inparanoid score I972
OMA 1 1.010
OrthoDB 1 1.010 D118111at33208
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 1 1.000 T1087339
orthoMCL 1 0.900 OOG5_129670
Panther 1 1.100 LDO PTHR12670
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.