DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and LOC100494440

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:XP_017951105.1 Gene:LOC100494440 ID: Length:761 Species:Xenopus tropicalis

Alignment Length:689 Identity:298/690 (43%)
Similarity:407/690 (59%) Gaps:43/690 (6%)


  Fly    25 YKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVV-EDEKGNRVAFVSADAGMMGYG 88
            |::||||.|.||...|:..||||...|:..|:|.|.::|||:: |.:...||.:||.:.|||...
 Frog    89 YRIGVGRTDCTGLLAEVPLMGYAKSDQIASGLHLRQYSRAFIIAEPDDSKRVVYVSTNIGMMSQR 153

  Fly    89 LKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGF-VPQTFEVMAQGLYLC 152
            ::.||::.|:..|||:|..|||.:|.::||..|.|:..:..:.::..|| .||| .|:..|:...
 Frog   154 VRLEVMEELKVNYGNLYREDNVILSASNTHSGPAGYFQYNTFVLASQGFNRPQT-NVIVSGIVKS 217

  Fly   153 IKRATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLG 217
            |:||..|:..|:|.::|.||.|..|||||||||.||..||.:|..:|||.:..|:.||:.:..:|
 Frog   218 IERAHQNMKRGKIFMNKGTVENSQINRSPSSYLLNPESERIRYSSNTDKDMVILKMVDMNDQDMG 282

  Fly   218 AFNWYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGP 282
            ..:|:|||..||.|.|:|::|||:|||:.|.|:|.|...:||.|.||.||..|||||||||.|||
 Frog   283 MISWFAVHGVSMGNANKLISSDNLGYASYLFEQEKNNRSLPGTGSFVAAFSPSNLGDVSPNTMGP 347

  Fly   283 KCSISGNECDLLTSRCPTGEG--DCFASGPGKDMFESTQILGQRLADAALGLLNEQSQESTAREV 345
            .|..:...||..||.||.| |  .|.|.||||||||||:|:|:|:...|..|....|     ||:
 Frog   348 HCVNANETCDNPTSTCPAG-GVMACVALGPGKDMFESTKIIGERIFLKAKELYGNAS-----REL 406

  Fly   346 TGDVRFIHQFVDMPNYNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPM 410
            ...|.|.||:|||.|.....     .:...::.|:||:|||||||||||.|:.:|.|||...:..
 Frog   407 DKKVNFAHQWVDMSNVTVKL-----NETHSVKTCKPALGYSFAAGTTDGAGSINFTQGTLEGDLY 466

  Fly   411 WNFVRD-FIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTM 474
            ||.:|| ::.||::|..:||.|||||:.||:...|..|.||||..|:..||.:.:.|:|.|||||
 Frog   467 WNAIRDLYLGAPSKETQECHHPKPILINTGQMDKPIPWHPKIVDIQMFTIGSIALLALPGEFTTM 531

  Fly   475 AGRRLRNQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMDV 539
            |||||:.:::......|.::|:|:::||.|:||.|..|.||||||||||||||:||||.|.|:.:
 Frog   532 AGRRLQEEVKKILDPSGTLNTDVVLSGLCNVYTHYITTYEEYQAQRYEAASTIYGPHTLSAYLQL 596

  Fly   540 FERLTKAMMRNET--VDAGPSPPYMNDVML--SLNTGVLFDGHPINTDFGYVKSQPNKEYGINET 600
            |..|.||::.|.|  :..||.||.:|:.:|  || ..|..|..|.|.|||.|.......|...:.
 Frog   597 FNGLAKAIVENTTDELPKGPRPPLINESLLPNSL-PPVPPDSTPANKDFGDVLKDVYPRYRRGDI 660

  Fly   601 VKVTYISGNPRN--NLFTEKTYFTIERKINEDRWKVAYTDASWETKMVWHR--TNTILGFSEMDI 661
            |..|:::.|||:  |..:|.:|..: ||.|..  .:.|.||||||:..||:  .|.    |....
 Frog   661 VSCTFVAANPRSGVNRMSESSYVYV-RKHNSR--VMLYNDASWETRYYWHKGPGNQ----SNATA 718

  Fly   662 YWDISPQTLPGEYRIRHSGEYK----------YILGGKY 690
            .|.|.....||.|.|...|.|:          ||.|..:
 Frog   719 EWHIPLSAEPGLYYIEVCGYYQPRSSFPVPQVYIGGSSF 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 298/690 (43%)
Ceramidase_alk 25..538 CDD:282576 242/518 (47%)
Ceramidse_alk_C 540..701 CDD:293653 56/170 (33%)
LOC100494440XP_017951105.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10310
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D118111at33208
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.