DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDase and asah2

Sequence 1:NP_001263109.1 Gene:CDase FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001123830.1 Gene:asah2 XenbaseID:XB-GENE-1003068 Length:763 Species:Xenopus tropicalis

Alignment Length:691 Identity:299/692 (43%)
Similarity:417/692 (60%) Gaps:33/692 (5%)


  Fly    27 VGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVV-EDEKGNRVAFVSADAGMMGYGLK 90
            :||||||.||...::..||||:..|:..|||||.::|||:: |.:...|:.:||||.||:...::
 Frog    87 IGVGRADCTGLLADVPLMGYASSDQLAGGIHTRQYSRAFIIAEPDNSKRLVYVSADIGMVSQRVR 151

  Fly    91 REVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCIKR 155
            .||:::|:|:|||:|..:||.:||||||..|.|:..:..:.::..||:....:.:..|:...|.:
 Frog   152 LEVMEKLKAKYGNLYRQENVILSGTHTHSGPAGYFQYTTFMLTGKGFIRPATDAIVNGIVKSIDQ 216

  Fly   156 ATDNLVDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGAFN 220
            |..|:..|||.|:|.||.|..:||||||||:||..||.:|..:|||.:..|:.||:.|..:|..:
 Frog   217 AHQNMKRGRIFLNKGTVENSQLNRSPSSYLQNPESERLRYPSNTDKDMVVLKMVDMHNQDMGIIS 281

  Fly   221 WYAVHATSMNNTNRLVTSDNVGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGPKCS 285
            |:||||.||.|.|.|::|||:|||:.|.|:|.|...:||:|.||.||.:||.||||||..||.|.
 Frog   282 WFAVHAVSMPNINHLISSDNLGYASYLFEQEKNSGYLPGEGPFVAAFTTSNHGDVSPNTKGPWCV 346

  Fly   286 ISGNECDLLTSRCPT-GEGDCFASGPGKDMFESTQILGQRLADAALGLLNEQSQESTAREVTGDV 349
            .:|:.||...|.||. |...|.|.|||.||||:|:|:|:.:...|..|.:..|     ||:...|
 Frog   347 NTGDSCDNPGSSCPIGGVSTCVALGPGNDMFENTKIIGEHIFQKAKELFSNSS-----RELEKKV 406

  Fly   350 RFIHQFVDMPN----YNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPM 410
            .|.||:|||.|    .|| |::..:        |:||:||||||||.||||..:|.||....:|.
 Frog   407 DFAHQWVDMSNVTVQLNG-THSATT--------CKPALGYSFAAGTIDGPGLINFTQGAVEGDPF 462

  Fly   411 WNFVRD-FIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTM 474
            |:.:|| .:..|:.|..:||.|||||:.||..:.|..|.|.||..|:..||.:.:.|||.|||||
 Frog   463 WDGIRDAILGVPSNETQECHSPKPILINTGEMSQPLPWHPTIVDVQMFTIGSLAMLAVPGEFTTM 527

  Fly   475 AGRRLRNQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMDV 539
            :|||||..::......|..|.:|:::||.|:||.|..|.||||||||||||||:||||.:.|..:
 Frog   528 SGRRLREDVQKVLDPAGTQDVQVVLSGLCNVYTHYITTFEEYQAQRYEAASTIYGPHTLAAYQQL 592

  Fly   540 FERLTKAMMRNETVD--AGPSPPYMNDVML-SLNTGVLFDGHPINTDFGYVKSQPNKEYGINETV 601
            |..|.:|::.|:..:  .||.||:.|:..| |....|..|..|.||.||.|..:...:|.:.|..
 Frog   593 FRGLARAIVENKVAELPKGPQPPFFNESQLFSFLLPVPVDKAPGNTTFGDVLEEVKPQYTVGEVA 657

  Fly   602 KVTYISGNPRNNL--FTEKTYFTIERKINED--RWKVAYTDASWETKMVWHRTNTILGFSEMDIY 662
            .||:::||||:::  ...|||..:| |.|:|  .|...:.||||||:..|::.:.......|:  
 Frog   658 SVTFVTGNPRSSVEHLAGKTYLAVE-KYNKDTGEWHTVHNDASWETRYYWNKVSRDQSNGTME-- 719

  Fly   663 WDISPQTLPGEYRIRHSGEYK--YILGGKYPYEGLTHSFTV 701
            |.|.|...||.|||.|.|.||  .:.....||||::..|.|
 Frog   720 WHIPPSAQPGIYRIHHFGHYKERNLPVTIKPYEGISSEFEV 760

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 298/690 (43%)
Ceramidase_alk 25..538 CDD:282576 238/518 (46%)
Ceramidse_alk_C 540..701 CDD:293653 60/170 (35%)
asah2NP_001123830.1 Ceramidase_alk 86..591 CDD:282576 238/518 (46%)
PTZ00487 87..760 CDD:240437 298/690 (43%)
Ceramidse_alk_C 593..760 CDD:293653 60/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256961123
eggNOG 1 0.900 E1_KOG2232
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10310
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D118111at33208
OrthoFinder 1 1.000 FOG0006479
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.