DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and RFU1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_013174.1 Gene:RFU1 SGDID:S000004063 Length:200 Species:Saccharomyces cerevisiae

Alignment Length:102 Identity:24/103 (23%)
Similarity:42/103 (41%) Gaps:10/103 (10%)


  Fly    35 MPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEKIRQHPDY---------GSVKAE 90
            :|:..|.::...:|..|....:..:...:||.|.||:.|...|:.:||:.         .|....
Yeast    20 IPLRIYLKTCIGILEKAQCAFQANDLSLSFIYYFRYVDLLTNKLSRHPELLRMDASSSSSSSYIH 84

  Fly    91 VRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLAS 127
            .|:..:.||.|: |...|:...|.|....:|.:...|
Yeast    85 KREYLQLIKLEV-PAVCKIIESLRTQIDSQYSKLQTS 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 22/93 (24%)
MPN_AMSH_like 247..419 CDD:163697
RFU1NP_013174.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12947
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.