DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and AMSH2

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001323286.1 Gene:AMSH2 AraportID:AT1G10600 Length:223 Species:Arabidopsis thaliana

Alignment Length:217 Identity:83/218 (38%)
Similarity:128/218 (59%) Gaps:8/218 (4%)


  Fly   211 PAASEAAADKTTNSKPSFDR---NQKPSYNRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNI 272
            |:.|.:..:..|.......|   :...:.|..:|..|..||.|::....:|.|.:||..||.|::
plant     7 PSPSLSCVENVTCKSSHVSRVLISGTDNINHGESSEAKILRDVHISERLLEDFTELARENTEKDL 71

  Fly   273 ETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFL 337
            ||||.||..|.:...|:|.:|.|:|:.|.:||..|:|.::|.:|::.:|..:|||||||:|..|:
plant    72 ETCGTLAAFLERGIFYVTTLIIPKQESTSNSCQAMNEVEVFSIQNERELYPVGWIHTHPSQGCFM 136

  Fly   338 SSVDLHTHCSYQIMMPEALAIVCAP--KYNTTGFFILTPHYGLDYIAQCRQSGFHPH--PND-PP 397
            ||||||||.|||:|:|||.|||.||  ...:.|.|.||...|::.:..|.::|||||  |.| .|
plant   137 SSVDLHTHYSYQVMVPEAFAIVVAPTDSSKSYGIFKLTDPGGMEVLRGCSETGFHPHKEPEDGNP 201

  Fly   398 LFMEAQHIRMDNQAKIKVIDLR 419
            ::....::..::..:.::.|||
plant   202 VYEHCSNVYKNSNLRFEIFDLR 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 75/177 (42%)
AMSH2NP_001323286.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D411229at2759
OrthoInspector 1 1.000 T125336
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12947
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.