DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and stambpa

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_956792.1 Gene:stambpa ZFINID:ZDB-GENE-040426-1551 Length:418 Species:Danio rerio

Alignment Length:428 Identity:186/429 (43%)
Similarity:271/429 (63%) Gaps:39/429 (9%)


  Fly    13 VEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEK 77
            |..::|::.|:..|:.::|.:::|..||:|||.|::||||:|..|||.|:|||||.:|:||||||
Zfish     9 VSSEDRVRALTKLGSSVDVSEDVPPRRYFRSGMEIIRMANIYADEGNVEHAFILYNKYITLFIEK 73

  Fly    78 IRQHPDYGSVK-AEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASKEAE---RVKELER 138
            :.:|.:|.:.. .|.::..||:|:...|..|:|:..||..|.:|:.::|..|.||   |..|:.:
Zfish    74 LPKHREYKTANIPEKKETMRKLKEIAFPKAEELKKLLLKQYDKEHAEYLVRKRAEDAARAVEMLK 138

  Fly   139 ERERERERQR-----QKEREKAGSSAIPSLI-----PANLHVLIDEGN---QPSAPDLGLLDQVV 190
            ::|:|.:|||     |::||:...||...:|     ......::.|.:   .|:|||:.|.|  |
Zfish   139 QQEQEAQRQRLAELHQRQREQEQFSAFEEMIRRQELEKERRRIVQEFSIPVSPTAPDVLLPD--V 201

  Fly   191 YPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSK--PSFDRNQKPS--YNRTDSLLAGSLRLVY 251
            :.           |....|.|....|.|   ||.:  |:|||:.|||  .:...|.|...||.::
Zfish   202 HG-----------PPQASLSPQTPPAGA---TNHQGLPAFDRSLKPSVPVSAGHSALVNGLRQLF 252

  Fly   252 VPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFDVQ 316
            ||.:..:.|||||..||::.:||||:|.|.|.:|...:||:|.|:|.|.||.|:|.:||::|.:|
Zfish   253 VPAELCQRFLKLAETNTARAVETCGILCGKLMKNAFTVTHVIVPKQCGGPDYCDTENEEELFLIQ 317

  Fly   317 DQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPHYGLDYI 381
            ||..|||||||||||||||||||||||||||||:|:||::||||:||:|.||:|.|| .||:|.:
Zfish   318 DQNDLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFNETGYFRLT-DYGMDDV 381

  Fly   382 AQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ..|:|.||||||.|||||..:.|:.: ....:.::|||
Zfish   382 GTCKQRGFHPHPKDPPLFAASHHVSI-TDGSVTMLDLR 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 44/104 (42%)
MPN_AMSH_like 247..419 CDD:163697 98/172 (57%)
stambpaNP_956792.1 USP8_dimer 13..114 CDD:286108 43/101 (43%)
MPN_AMSH_like 248..418 CDD:163697 98/172 (57%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 329..342 13/13 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330530593
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 1 1.000 H4719
Inparanoid 1 1.050 339 1.000 Inparanoid score I2301
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T597251
orthoMCL 1 0.900 OOG5_130679
Panther 1 1.100 LDO PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.