DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and Stambpl1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001347645.1 Gene:Stambpl1 MGIID:1923880 Length:436 Species:Mus musculus

Alignment Length:431 Identity:178/432 (41%)
Similarity:252/432 (58%) Gaps:42/432 (10%)


  Fly    13 VEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEK 77
            :.|:||::.||..|..|.:::::...||:|||.||.|||:|||.|||.||||:||.:::|||:||
Mouse    24 LSPEERVRALSKLGCNISINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLYNKFITLFVEK 88

  Fly    78 IRQHPDYGSVKA-EVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASK---EAERVKELER 138
            :..|.||..... |.:||.:|:|:...|.|::|:..||..|..||:::|.||   :||.:|:||.
Mouse    89 LPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKTDLLRKYNIEYQEYLQSKNKYKAEILKKLEH 153

  Fly   139 ERERERERQR-------QKERE---------KAGSSAIPSLIPANLHVLID--EGNQPSAPDLGL 185
            :|..|.||||       |.|.|         |....|...:...:..||.:  :|:..|.     
Mouse   154 QRLIEAERQRIAQMRQQQLESEQFLFFEDQLKKQELARGQIRGQDSPVLSEQTDGSALSC----- 213

  Fly   186 LDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKP--SYNRTDSLLAGSLR 248
                     |.|..:.||..:....|..|:.:  ...|..|..:|..||  :.:...:|:...||
Mouse   214 ---------FSTHQSNSLRNAFADHPHKSDGS--NFANYSPPVNRALKPAATLSAVQNLVVEGLR 267

  Fly   249 LVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIF 313
            .|.:..|....||.||.:||.:.|||||:|.|.|:.|:..|||::.|:|...||.|:..:.|::|
Mouse   268 CVVLSRDLCHKFLLLADSNTVRGIETCGILCGKLTHNEFTITHVVVPKQSAGPDYCDVENVEELF 332

  Fly   314 DVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPHYGL 378
            :||||..|:|||||||||||||||||||||||||||:|:|||:||||:||:..||.|.|| :.|:
Mouse   333 NVQDQHGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLT-NAGM 396

  Fly   379 DYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ..::.|::.|||||..||.||....|: :....|..|:|||
Mouse   397 LEVSTCKKKGFHPHTKDPKLFSICSHV-LVKDIKTTVLDLR 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 47/104 (45%)
MPN_AMSH_like 247..419 CDD:163697 92/172 (53%)
Stambpl1NP_001347645.1 USP8_dimer 22..129 CDD:312504 47/105 (45%)
Trigger_N <119..>195 CDD:331827 25/76 (33%)
MPN_AMSH_like 266..436 CDD:163697 92/172 (53%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 347..360 13/13 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330527804
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2451
Isobase 1 0.950 0 Normalized mean entropy S4988
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T616415
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.820

Return to query results.
Submit another query.