DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and Stambp

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001349007.1 Gene:Stambp MGIID:1917777 Length:424 Species:Mus musculus

Alignment Length:443 Identity:191/444 (43%)
Similarity:265/444 (60%) Gaps:57/444 (13%)


  Fly    11 GDVE--PQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTL 73
            |||.  ||:|::.||..|:.:|:::::|..||||||.|::|||:||..|||.|:|||||.:|:||
Mouse     5 GDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAFILYNKYITL 69

  Fly    74 FIEKIRQHPDYGS-VKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASKEAERVKELE 137
            ||||:.:|.||.| :..|.:|..:|:|....|..|:|:.:||..|.:||||:...|:.|. :||.
Mouse    70 FIEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQYKERKKKEE-EELA 133

  Fly   138 R------ERERERER---QRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSAPDLGLLDQVVYPN 193
            |      |.|:|::|   |:||:.|:....|...:|...   .:::.......:.|.:|      
Mouse   134 RNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQ---ELEKERLKIVQEFGKVD------ 189

  Fly   194 DFPTGANRSLPG-SGLLLPAASEAAADKTTNS------------------KPSFDRNQKP---SY 236
                      || .|.|||...:...|...:|                  .|..||:.||   |.
Mouse   190 ----------PGPCGPLLPDLEKPCVDVAPSSPFSPTQTPDCNTGMRPAKPPVVDRSLKPGALSV 244

  Fly   237 NRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTP 301
            ......:.| ||.:.||.:....||:||.|||:|.|||||||.|.|.:|:..|||::.|:|.|.|
Mouse   245 IENVPTIEG-LRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVLIPRQNGGP 308

  Fly   302 DSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNT 366
            |.|:|.:||:||.:||.:.|:|||||||||||||||||||||||||||:|:||::||||:||:..
Mouse   309 DYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQE 373

  Fly   367 TGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ||||.|| .|||..|:.|||.|||||..|||||.:..|:.:.::. :.:.|||
Mouse   374 TGFFKLT-DYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRI-VTITDLR 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 49/104 (47%)
MPN_AMSH_like 247..419 CDD:163697 101/172 (59%)
StambpNP_001349007.1 Interaction with CHMP3. {ECO:0000250} 1..127 58/122 (48%)
USP8_dimer 7..114 CDD:312504 50/107 (47%)
Interaction with STAM1. {ECO:0000250} 227..231 0/4 (0%)
MPN_AMSH_like 254..424 CDD:163697 101/172 (59%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 335..348 13/13 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330533566
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 1 1.000 H4719
Inparanoid 1 1.050 326 1.000 Inparanoid score I2451
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T616415
orthoMCL 1 0.900 OOG5_130679
Panther 1 1.100 LDO PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.