DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and Stambpl1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001108520.1 Gene:Stambpl1 RGDID:1583011 Length:436 Species:Rattus norvegicus

Alignment Length:421 Identity:177/422 (42%)
Similarity:247/422 (59%) Gaps:22/422 (5%)


  Fly    13 VEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEK 77
            :.|:||::.||..|..|.:::::...||:|||.||.|||:|||.|||.||||:||.:::|||:||
  Rat    24 LSPEERVRALSKLGCNISINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLYNKFITLFVEK 88

  Fly    78 IRQHPDYGSVKA-EVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASK---EAERVKELER 138
            :..|.||..... |.:||.:|:|:...|.|::|:..||..|..||:::|.||   :||.:|:||.
  Rat    89 LPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKTDLLRKYNIEYQEYLQSKNKYKAEILKKLEH 153

  Fly   139 ERERERERQR--QKEREKAGSSAIPSLIPANLHVLIDEGNQPSAPDLGLLDQVVYPND------F 195
            :|..|.||||  |..:::..|..............:..|.......|.|.:|    .|      |
  Rat   154 QRLIEAERQRIAQMRQQQLESEQFLFFEDQLKKQELARGQTRGQDSLVLSEQ----TDGSGLSCF 214

  Fly   196 PTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKP--SYNRTDSLLAGSLRLVYVPGDTME 258
            .|..|.||.......|..|:..  ...|..|..:|..||  :.:...:|:...||.|.:..|...
  Rat   215 STHQNNSLRNVFADHPQKSDVC--DLANYSPPVNRALKPAATLSAVQNLVVEGLRCVVLSRDLCH 277

  Fly   259 VFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFDVQDQMQLIT 323
            .||.||.:||.:.|||||:|.|.|:.|:..|||::.|:|...||.|:..:.|::|.||||..|:|
  Rat   278 KFLLLADSNTVRGIETCGILCGKLTHNEFTITHVVVPKQSAGPDYCDVENVEELFSVQDQHGLLT 342

  Fly   324 LGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPHYGLDYIAQCRQSG 388
            ||||||||||||||||||||||||||:|:|||:||||:||:..||.|.|| :.|:..::.|::.|
  Rat   343 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLT-NAGMLEVSTCKKKG 406

  Fly   389 FHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ||||..||.||....|: :....|..|:|||
  Rat   407 FHPHTKDPKLFSICSHV-LVKDIKTTVLDLR 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 47/104 (45%)
MPN_AMSH_like 247..419 CDD:163697 92/172 (53%)
Stambpl1NP_001108520.1 USP8_dimer 28..129 CDD:286108 46/101 (46%)
GBP_C <134..>188 CDD:303769 16/54 (30%)
MPN_AMSH_like 266..436 CDD:163697 92/172 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330527620
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 325 1.000 Inparanoid score I2367
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T618534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12947
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.