DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and STAMBPL1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_065850.1 Gene:STAMBPL1 HGNCID:24105 Length:436 Species:Homo sapiens

Alignment Length:429 Identity:178/430 (41%)
Similarity:251/430 (58%) Gaps:38/430 (9%)


  Fly    13 VEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEK 77
            :.|:||::.||..|..|.:.:::...||:|||.||.|||:|||.|||.||||:||.:::|||:||
Human    24 LSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLYNKFITLFVEK 88

  Fly    78 IRQHPDYGSVKA-EVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASK---EAERVKELER 138
            :..|.||..... |.:||.:|:|:...|.|::|:..||..|..||:::|.||   :||.:|:||.
Human    89 LPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEH 153

  Fly   139 ER--ERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSAPDLGLLDQVVYPND------F 195
            :|  |.||:|..|..:::..|..............:..|...|....||.:|:    |      |
Human   154 QRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQI----DGSALSCF 214

  Fly   196 PTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNR----------TDSLLAGSLRLV 250
            .|..|.||          ....||:...|..:...:..|..||          ..:|:...||.|
Human   215 STHQNNSL----------LNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCV 269

  Fly   251 YVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFDV 315
            .:|.|....||:||.:||.:.|||||:|.|.|:.|:..|||:|.|:|...||.|:..:.|::|:|
Human   270 VLPEDLCHKFLQLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNV 334

  Fly   316 QDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPHYGLDY 380
            |||..|:|||||||||||||||||||||||||||:|:|||:||||:||:..||.|.|| :.|:..
Human   335 QDQHDLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLT-NAGMLE 398

  Fly   381 IAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ::.|::.|||||..:|.||...:|: :....||.|:|||
Human   399 VSACKKKGFHPHTKEPRLFSICKHV-LVKDIKIIVLDLR 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 47/104 (45%)
MPN_AMSH_like 247..419 CDD:163697 94/172 (55%)
STAMBPL1NP_065850.1 USP8_dimer 28..129 CDD:286108 46/101 (46%)
GBP_C <120..198 CDD:303769 23/78 (29%)
MPN_AMSH_like 266..436 CDD:163697 94/172 (55%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 347..360 13/13 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330528761
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2442
Isobase 1 0.950 0 Normalized mean entropy S4988
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T609596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.850

Return to query results.
Submit another query.