DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and stambpl1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_009304952.1 Gene:stambpl1 ZFINID:ZDB-GENE-100215-4 Length:466 Species:Danio rerio

Alignment Length:389 Identity:146/390 (37%)
Similarity:209/390 (54%) Gaps:88/390 (23%)


  Fly    17 ERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEKIRQH 81
            ||::.||..|..||:::::...||:|||.||.|||.|||.||:.||||:||.:::|||:||:..|
Zfish    28 ERVRALSKMGYNIEINEDIAPRRYFRSGVEMERMAAVYLEEGSLENAFVLYNKFITLFVEKLPSH 92

  Fly    82 PDYGSVK-AEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASK-----------EAERVK 134
            .||.... .|.:.|.:|:::...|..::|:..|...|.:|:.::|.|:           :.:::.
Zfish    93 RDYQQCNIPEKQVIMKKLQEVAFPRKDQLKRLLHEKYSKEHSEYLKSQTQAMAVDMCGAQLQKMS 157

  Fly   135 ELERERER-----------------ERERQRQK---EREKAGSSAIP--------SLIPANLHVL 171
            .||.||:|                 |.:.:||:   .|:.||.. :|        |..|.| ||.
Zfish   158 MLEEERQRVAQLRKMQIESEQFRYFEDQLRRQELASRRDDAGPK-VPEQTDGSCLSQTPRN-HVR 220

  Fly   172 IDEGNQPSAPDLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSY 236
            :|                         .||:.|.:.:..|||:.||.           :||:   
Zfish   221 LD-------------------------PNRNKPAAPIPKPAATLAAV-----------QNQR--- 246

  Fly   237 NRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTP 301
                   ...||.|.:|.|....||.||.:||::.|||||||.|.|:.|:..:||:|.|:|...|
Zfish   247 -------VEGLRRVLIPRDLTYRFLLLADSNTARGIETCGVLCGKLTHNEFVLTHVIVPKQSAGP 304

  Fly   302 DSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYN 365
            |.|:..:.|::|..||...|:|||||||||||||||||||||||.|||:|:|||:|||||||:|
Zfish   305 DYCDMENVEELFSYQDHHNLLTLGWIHTHPTQTAFLSSVDLHTHSSYQLMLPEAIAIVCAPKHN 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 43/103 (42%)
MPN_AMSH_like 247..419 CDD:163697 72/120 (60%)
stambpl1XP_009304952.1 USP8_dimer 28..130 CDD:286108 43/102 (42%)
MPN_AMSH_like 250..>369 CDD:163697 72/120 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330532298
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2301
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T597251
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.