DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and stambpl1

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_989010.1 Gene:stambpl1 XenbaseID:XB-GENE-5752500 Length:429 Species:Xenopus tropicalis

Alignment Length:438 Identity:171/439 (39%)
Similarity:251/439 (57%) Gaps:61/439 (14%)


  Fly    13 VEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEK 77
            :.|:||::.||..|..|.:::::...||:|||.||.|||:|||.|||.||||:||.:::|||:||
 Frog    22 LSPEERVRALSKLGCNITINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLYNKFITLFVEK 86

  Fly    78 IRQHPDYGSVK-AEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLA---SKEAERVKELER 138
            :..|.||...: .|.:||.:|:|:...|.|::|:..||..|..||:::|.   .::||.:|:||:
 Frog    87 LPGHRDYQQYEIPEKQDILKKLKEVAFPRTDELKKDLLKKYNLEYQEYLQGVHKRKAECLKKLEQ 151

  Fly   139 ERERERE-------RQRQKEREK--------------------AGSSAIPSLIPANLHVLIDEGN 176
            ::..|.|       ||:|.:.|:                    ..:..:|..|...:...|....
 Frog   152 QQLIEAEKKRLAQIRQQQIQTEQFSFFEDQLRKQDQVRDQLKIKDAPKVPEQIDGGMVTCISNAK 216

  Fly   177 QPSAPDLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNRTDS 241
            ..........|..:|....|       |.:..|.|||:.:|.           :|:         
 Frog   217 SSCTEQAKRNDASIYTGQSP-------PVTRALKPAATLSAV-----------QNE--------- 254

  Fly   242 LLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNT 306
             :...||.|.:|.|..:.||:||.||||:.|||||:|.|.|:.::..|||:|.|:|...||.|:.
 Frog   255 -IVDGLRPVVLPRDLSQRFLQLAEANTSRGIETCGILCGKLTHDEFTITHVIVPKQSAGPDYCDM 318

  Fly   307 MHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFI 371
            .:.|::|:||||..|:|||||||||||||||||||||||||||:|:|||:||||:||:|.||.|.
 Frog   319 ENVEELFNVQDQHNLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGIFR 383

  Fly   372 LTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            || ..|:..::.|::.|||||..:|..|...:|:.:.: |.|.|:|||
 Frog   384 LT-SAGMLEVSACKKKGFHPHSKEPRQFNTCRHVTVQD-AGITVLDLR 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 47/104 (45%)
MPN_AMSH_like 247..419 CDD:163697 95/172 (55%)
stambpl1NP_989010.1 USP8_dimer 20..129 CDD:312504 48/107 (45%)
Trigger_N <65..>199 CDD:331827 42/134 (31%)
MPN_AMSH_like 259..429 CDD:163697 95/172 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330535783
eggNOG 1 0.900 E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.