DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and sst2

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001342969.1 Gene:sst2 PomBaseID:SPAC19B12.10 Length:435 Species:Schizosaccharomyces pombe

Alignment Length:452 Identity:161/453 (36%)
Similarity:239/453 (53%) Gaps:59/453 (13%)


  Fly     7 NMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYM 71
            |:..|...|....:..|..| ..:.:||:|:..:.|:.|.:.:.|:||:.|.::.|...|..||.
pombe     2 NILQGSEAPLSYEEIASRAG-AFDFNKNIPLKNWLRTSTTISKQAHVYVSEHDYSNGVFLLFRYC 65

  Fly    72 TLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE-YEQFLASK-EAERVK 134
            .||: |.::|||..:.|.|:.|..:.:::.:    |::  :|:....:| |||:...| :.:.:|
pombe    66 ELFM-KCQKHPDAAAYKKELFDYYQGVRNAL----EEI--ELIKPIVKEQYEQYQCQKNDLDDLK 123

  Fly   135 ELERERERERERQRQKER----------EKAGSSAIPSLIPANLHVLIDEGNQ--PSAPDLGLLD 187
            :|..     ::.|...|:          |:...|.:..|.|::..:|..:..:  .|:.||...|
pombe   124 KLSM-----KDSQPSLEKPVSYVDEPILEQWALSDLQILPPSSTDLLSPDSQKLSKSSSDLPQFD 183

  Fly   188 QVVYP--NDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRN-----QKPSYNRTDS---L 242
               ||  |..|| .|.:||.|.......| .:..|..:.:|..|..     :||.|.||..   .
pombe   184 ---YPSLNSSPT-FNSNLPISSSRFEKTS-LSDSKLVSPEPLDDNKDIQFIKKPIYTRTSEPRPK 243

  Fly   243 LAGS------------LRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITP 295
            .||:            ||.:|:|....:|||.:...||.||:||||:|.|.|.||..:|||::.|
pombe   244 PAGTFKIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLETCGILCGKLRQNAFFITHLVIP 308

  Fly   296 QQQGTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVC 360
            .|:.|.|:|.|..|..:|:.||:..|:||||||||||||.|:||||||||||||:|:|||:|||.
pombe   309 LQEATSDTCGTTDEASLFEFQDKHNLLTLGWIHTHPTQTCFMSSVDLHTHCSYQLMLPEAIAIVM 373

  Fly   361 APKYNTTGFFILTPHYGLDYIAQCRQSG-FHPHPNDPPLFMEAQ--HIRMDNQAKIKVIDLR 419
            ||..||:|.|.|....||..|.:||:.| |||| ......|.||  |:|..| :|::|:|||
pombe   374 APSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPH-EGKVYTMVAQPGHVREIN-SKLQVVDLR 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 26/103 (25%)
MPN_AMSH_like 247..419 CDD:163697 93/175 (53%)
sst2NP_001342969.1 USP8_dimer <26..111 CDD:312504 27/92 (29%)
MPN_AMSH_like 260..433 CDD:163697 93/175 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I873
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T1125062
orthoMCL 1 0.900 OOG5_130679
Panther 1 1.100 LDO PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.