DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2224 and Stambp

Sequence 1:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_612540.1 Gene:Stambp RGDID:619963 Length:424 Species:Rattus norvegicus

Alignment Length:434 Identity:188/435 (43%)
Similarity:266/435 (61%) Gaps:49/435 (11%)


  Fly    15 PQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTLFIEKIR 79
            ||:|::.||..|:.:|:::::|..||:|||.|::|||::|..|||.|:|||||.:|:||||||:.
  Rat    11 PQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLP 75

  Fly    80 QHPDYGS-VKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASKEAERVKELER----- 138
            :|.||.| :..|.:|..:|:|:...|..|:|:.:||..|.:||||:...|:.|. :||.|     
  Rat    76 KHRDYKSAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQYKERKKKEE-EELARNIAIQ 139

  Fly   139 -ERERERER---QRQKEREKAGSSAIPSLI------PANLHVL-----IDEGN-QPSAPDLGLLD 187
             |.|:|::|   |:||:.|:....|...:|      ...|.::     :|.|. .|..|||....
  Rat   140 QELEKEKQRVAQQKQKQLEQEQFHAFEKMIQKQELEKERLKIVQEFGKVDPGPCGPLLPDLEKPC 204

  Fly   188 QVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPS----FDRNQKP---SYNRTDSLLAG 245
            ..|.|:.                |.:....:|..|..:|:    .||:.||   |.......:.|
  Rat   205 VDVAPSS----------------PFSPTQTSDCNTTLRPAKPPVVDRSLKPGALSVIENVPTIEG 253

  Fly   246 SLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEE 310
             ||.:.||.:....||:||.|||:|.|||||||.|.|.:|:..|||::.|:|.|.||.|:|.:||
  Rat   254 -LRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVLIPRQNGGPDYCHTENEE 317

  Fly   311 QIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPH 375
            :||.:||.:.|:|||||||||||||||||||||||||||:|:||::||||:||:..||||.|| .
  Rat   318 EIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLT-D 381

  Fly   376 YGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            |||..|:.|||.|||||..|||||.:..|:.:.::. :.:.|||
  Rat   382 YGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRI-VTITDLR 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 47/104 (45%)
MPN_AMSH_like 247..419 CDD:163697 101/172 (59%)
StambpNP_612540.1 Interaction with CHMP3. {ECO:0000250} 1..127 53/116 (46%)
USP8_dimer 12..114 CDD:286108 46/102 (45%)
Interaction with STAM1. {ECO:0000250} 227..231 1/4 (25%)
MPN_AMSH_like 254..424 CDD:163697 101/172 (59%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 335..348 13/13 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330527843
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 1 1.000 H4719
Inparanoid 1 1.050 325 1.000 Inparanoid score I2367
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T618534
orthoMCL 1 0.900 OOG5_130679
Panther 1 1.100 LDO PTHR12947
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.