DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and smpdl3b

DIOPT Version :8

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001315485.1 Gene:smpdl3b / 564392 ZFINID:ZDB-GENE-041008-132 Length:457 Species:Danio rerio

Alignment Length:486 Identity:129/487 (26%)
Similarity:212/487 (44%) Gaps:103/487 (21%)


  Fly   217 HLTDIHYDPEYAEGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPKRLILSAFEHIKEN 281
            |::|:|:||.|...|::...    |.:|   |...:..||.:.|| .||.|..||.|:...::| 
Zfish    28 HISDLHWDPSYDLSSSSQSK----CASS---GGRPTPHAGRYGDY-VCDSPWSLINSSLTAMRE- 83

  Fly   282 HKI----EWIYHTGDVPPHNVWSTT-RQGNLDMLSEIDELLAKYFPDTPIYPCLGNHEPHPANVF 341
              |    ::|..|||..||...... .|..|.::..:..::...||.|.:|..:|||:.||.|  
Zfish    84 --ILPDPDFIMWTGDDTPHVPDDQLGEQAVLRIIGNLTNIIKSTFPKTKVYSAMGNHDYHPKN-- 144

  Fly   342 GNDEIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYTAS--PSKGHRIVALNSMDCYLYNW 404
               ::|.:...  :||...:||..||...::||...|||||..  ...|.|::.||:.       
Zfish   145 ---QMPPAKST--IYEQTANLWRDWLHTASQETFKTGGYYTEKLLNQTGLRVIVLNTN------- 197

  Fly   405 WLFYNATLIQE-------QLQWFHDTLLSAEEAGESVHILTHIPAG-------DGDCWCNWSQEY 455
             |:|:...:.|       |..|....|..|.:..|.|:::.|:|.|       .|  |  :.:|:
Zfish   198 -LYYDQNKLTEKVKDPADQFSWADKVLQDAAKNNEKVYLIGHVPPGLFEKKRDKG--W--FRKEF 257

  Fly   456 NR----VLTRFNGIITGVFSGHTHKDEMNLHYSEDG------YAT--VVNW--------NGGSLT 500
            |:    ::.:.:.:|.|.|.||.|.|...:.|:..|      |.|  |..|        :||:  
Zfish   258 NKRYIELIQKHSAVIMGQFFGHHHTDSFRMFYNSKGSPISAMYLTPGVTPWITTLPGVIDGGN-- 320

  Fly   501 SYSNKNPNYRLYELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEY-TEDTSPAGID 564
                 ||..|::|...:...|.|..||..|||.||:.   :.:||.||:.|:.: ..|.|||.:.
Zfish   321 -----NPGIRIFEYDTKTLLVKDIITYYLNLTYANIA---RARWEKEYRLTEAFRVPDASPASMH 377

  Fly   565 RLLLEMAEKPDLLRKFWRNKFTNSDPKLAEGCDNACLSKTICRIATSNYQERTRCKELQAILAES 629
            |::..::.:...|:|::.....:.|  |:| |...|....:|.:...:|....:|     :|.| 
Zfish   378 RVMERISSEKCSLQKYFELNSVSYD--LSE-CHADCRVDHVCALREVDYDAYEKC-----VLKE- 433

  Fly   630 LENEPDTDDNNGGGAAGLSALSLASLLALLA 660
                        ||::....|.:..|..:|:
Zfish   434 ------------GGSSNAPVLFILFLSLMLS 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 91/334 (27%)
Metallophos 271..477 CDD:278574 62/231 (27%)
smpdl3bNP_001315485.1 MPP_ASMase 26..325 CDD:277321 91/334 (27%)
Metallophos 26..283 CDD:278574 80/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.