DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and ZK856.5

DIOPT Version :8

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_505620.4 Gene:ZK856.5 / 191439 WormBaseID:WBGene00014106 Length:459 Species:Caenorhabditis elegans

Alignment Length:462 Identity:128/463 (28%)
Similarity:182/463 (39%) Gaps:92/463 (20%)


  Fly   205 LPAKTSEDILVLHLTDIHYDPEYA-EGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPK 268
            ||.| |....||||.|.|.|.:|: .|.|    :.||    ..:|::.:...|.:.||. ||.||
 Worm    14 LPLK-SWGYQVLHLADFHLDVQYSINGDN----KHMC----HDDGTERNTTLGEYGDYM-CDAPK 68

  Fly   269 RLILSAFEHIKENHKI----EWIYHTGDVPPH---NVWSTTRQGNLDMLSEIDELLAKYFPDTPI 326
            .||..|   |.|:.:|    :.|..|||...|   ..|...    ||.:::...||...||:..|
 Worm    69 PLIQLA---IDESARIFPNPDLIIWTGDNVAHIDGYGWEIV----LDAVNQTTSLLFSRFPNQTI 126

  Fly   327 YPCLGNHEPHPANVFGNDEIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYTASPSKGHRI 391
            .|..|||:..|:|.|   |..||     ||...|.||...|..|.:.|.|:||||.         
 Worm   127 LPTFGNHDYAPSNGF---ESESS-----LYTKTWELWKGKLGDENKATFLKGGYYK--------- 174

  Fly   392 VALNSMDCYLYNWWLFYNATLI----------QEQLQWFHDTLLSAEEAGES--------VHILT 438
            ..|.:....:.|..|:|||...          .:|..:....|.:||:....        |||:.
 Worm   175 YRLRNATAVVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVA 239

  Fly   439 HIPAGDGDCWCNWS---QEYNR----VLTRFNGIITGVFSGHTHKDEMNLHYSEDG--------- 487
            ||..|..:...|::   .|||.    :..|:...|..:..||.|.|  ..|..:|.         
 Worm   240 HIGPGVFEKTPNFTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTD--TFHLIKDSKENNVQLAL 302

  Fly   488 -YATVVNWNGGSLTSYSNKNPNYRLYELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFT 551
             ...|..| ...|......||.:|:||....: ::.|..||..||.:.|  .::...:..||.|.
 Worm   303 MAPAVTPW-FSDLPGAGANNPTFRVYETDAYS-KIQDISTYFINLDDLN--KNKSTPFVFEYSFK 363

  Fly   552 KEY--TEDTSPAGIDRLLLEMAEKPDLLRKF--WRNKFTNSDPKLAEGCDNACLSKTICRIATSN 612
            ..|  |.|.:|..:..||.:|.....|.:|:  :...|.|  |::..|.....   .:|.:..|:
 Worm   364 DAYGITGDINPTTMSALLDKMKNNDTLFKKYIDYNTAFWN--PQMPLGVYRGA---QLCSMEYSD 423

  Fly   613 YQERTRC 619
            |.....|
 Worm   424 YPRYYSC 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 95/338 (28%)
Metallophos 271..477 CDD:278574 66/238 (28%)
ZK856.5NP_505620.4 MPP_ASMase 23..325 CDD:277321 95/338 (28%)
Metallophos 73..285 CDD:278574 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.