DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and smpd1

DIOPT Version :8

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_002943546.1 Gene:smpd1 / 100487433 XenbaseID:XB-GENE-997694 Length:582 Species:Xenopus tropicalis

Alignment Length:555 Identity:176/556 (32%)
Similarity:255/556 (46%) Gaps:67/556 (12%)


  Fly    99 CTLCRSTINVFARTFTEGELSGPERDDEAKKLMLGM----CDYFAISTQEVCSGLFDL------- 152
            |.:|:.   :||......|:      |..|:::..:    |....::...||.....|       
 Frog    50 CPICKV---LFAALDISLEV------DSNKEMVASLAERVCMALRLAEPSVCQQTIQLFKKDIIT 105

  Fly   153 NWPILDFILNETVAKSNTFCSMLPIPICQVKQDEYNLTLSIQGDLPQESNSNLPAKTSEDIL--- 214
            .|.:       :|.:.:..|.:|....|.|            .|:....|.:||.|....::   
 Frog   106 AWVL-------SVLRPSEICGLLVGADCGV------------WDIGSNWNISLPNKPKPPVVPPV 151

  Fly   215 ----------VLHLTDIHYDPEYAEGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPKR 269
                      ||.|||:|:|.:|..||:|:|.||:|||  :|...:.| .||:|..|..||.|..
 Frog   152 PPTPGSPVSRVLFLTDLHWDRQYLPGSSASCQEPLCCR--MPPAHNQS-GAGYWGTYSKCDLPLH 213

  Fly   270 LILSAFEHIKENHKIEWIYHTGDVPPHNVWSTTRQGNLDMLSEIDELLAKYFPDTPIYPCLGNHE 334
            .|.|....:......:.:|.|||:|.||||..||...||.|..:..|:.||....|:||.:||||
 Frog   214 TIESLLRQVSAQGPYQAVYWTGDIPAHNVWQQTRADQLDALRTLTGLIRKYLGAVPVYPAVGNHE 278

  Fly   335 PHPANVFGNDEIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYTASPSKGHRIVALNSMDC 399
            ..|.|.|....:..:|...|||..:...|..|||..|..|:...|:||.......|:|:||...|
 Frog   279 STPVNSFPPPYVQGNLSSHWLYHSMAQEWHHWLPQSALSTLRTAGFYTVPIGPRLRLVSLNMNFC 343

  Fly   400 YLYNWWLFYNATLIQEQLQWFHDTLLSAEEAGESVHILTHIPAGDGDCWCNWSQEYNRVLTRFNG 464
            .|.|:||..|.|....||||..:.|..|||.||.|||:.|||  .|.|..:||..|.|::.|:..
 Frog   344 DLGNFWLLINYTDPAGQLQWLVEVLQEAEEKGEKVHIIGHIP--PGLCLKSWSWNYYRIVNRYES 406

  Fly   465 IITGVFSGHTHKDEMNLHYSEDGYATVVN--WNGGSLTSYSNKNPNYRLYEL---HPE-NWQVLD 523
            .|...|.||||.||..:.|.|:.....|:  :...|:|::.|.||.||:|::   :|| :..|||
 Frog   407 TIAAQFFGHTHLDEFEMFYDEETLTRPVSVAFISPSVTTFINLNPGYRVYQIDGEYPESSHMVLD 471

  Fly   524 HHTYTFNLTEANLTPDEQPKWELEYQFTKEY-TEDTSPAGIDRLLLEMAEKPDLLRKFWRNKFTN 587
            |.||..||||||..|.:.|:|.|.|:..:.| .:...||..:.|.....:...|.:.||   :.:
 Frog   472 HETYILNLTEANARPGQDPRWTLLYRALETYGMKSAFPADWELLTRRFLQDERLFQTFW---YLH 533

  Fly   588 SDPKLAEGCDNACLSKTICRIATSNYQERTRCKEL 622
            ....:.|.|...|.:..:|.:.:....:...||:|
 Frog   534 HKGHVDEVCQENCKTTLLCALRSGRSSDPELCKDL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 119/297 (40%)
Metallophos 271..477 CDD:278574 82/206 (40%)
smpd1XP_002943546.1 SapB 48..121 CDD:214797 14/87 (16%)
MPP_ASMase 162..454 CDD:277321 119/297 (40%)
Metallophos 212..417 CDD:278574 81/207 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.