powered by:
Protein Alignment CecC and CecA1
DIOPT Version :9
Sequence 1: | NP_524591.1 |
Gene: | CecC / 43599 |
FlyBaseID: | FBgn0000279 |
Length: | 63 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524588.1 |
Gene: | CecA1 / 43596 |
FlyBaseID: | FBgn0000276 |
Length: | 63 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 58/63 - (92%) |
Similarity: | 62/63 - (98%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG 63
||||.|||||||||||:|||||||||||:||:|||:|||||||||||||||||||||||||||
Fly 1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45469164 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2FBF1 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
47 |
1.000 |
Inparanoid score |
I7678 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014291 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm49915 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR38329 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.890 |
|
Return to query results.
Submit another query.