DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CecC and CecA1

Sequence 1:NP_524591.1 Gene:CecC FlyBaseID:FBgn0000279 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524588.1 Gene:CecA1 FlyBaseID:FBgn0000276 Length:63 Species:Drosophila melanogaster

Alignment Length:63 Identity:58/64 (91%)
Similarity:62/64 (97%) Gaps:0/64 (0%)


  Fly     1 MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG 63
            ||||.|||||||||||:|||||||||||:||:|||:|||||||||||||||||||||||||||
  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CecCNP_524591.1 Cecropin 29..61 CDD:278690 29/32 (91%)
CecA1NP_524588.1 Cecropin 28..61 CDD:306727 30/33 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131142104
eggNOG 1 0.900 E1_2FBF1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR38329
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.