DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecA1 and CecA2

DIOPT Version :10

Sequence 1:NP_524588.1 Gene:CecA1 / 43596 FlyBaseID:FBgn0000276 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524589.1 Gene:CecA2 / 43597 FlyBaseID:FBgn0000277 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:63/63 - (100%)
Similarity:63/63 - (100%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecA1NP_524588.1 Cecropin 28..57 CDD:425572 28/28 (100%)
CecA2NP_524589.1 Cecropin 28..57 CDD:425572 28/28 (100%)

Return to query results.
Submit another query.