DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecA1 and LOC1272403

DIOPT Version :10

Sequence 1:NP_524588.1 Gene:CecA1 / 43596 FlyBaseID:FBgn0000276 Length:63 Species:Drosophila melanogaster
Sequence 2:XP_311223.2 Gene:LOC1272403 / 1272403 VectorBaseID:AGAMI1_013976 Length:58 Species:Anopheles gambiae


Alignment Length:94 Identity:20/94 - (21%)
Similarity:38/94 - (40%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HAKFTESLVEEDDVYVDQYLEAFKELYKFF--QLMGTVFGFVSSDVKEKVEILEKLRGKENADSF 74
            ||.||..   :..:|..|.:.:......|.  .|...:.|.::|.:..:: :|.|.:...|:.| 
Mosquito   168 HAAFTPG---DQKLYYCQTIASSTGSVWFVIAPLYAVMIGQIASRIVFEL-LLRKNKALRNSVS- 227

  Fly    75 LTIRTMMQYEQESNLLNKKDYVSGSRTLL 103
            |::.|....:|....|.....:....||:
Mosquito   228 LSLSTRFNLDQSIRSLRALKLLVNCNTLV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecA1NP_524588.1 Cecropin 28..57 CDD:425572 5/30 (17%)
LOC1272403XP_311223.2 Cecropin 28..57 CDD:425572
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.