DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and ADS4

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172124.2 Gene:ADS4 / 837146 AraportID:AT1G06350 Length:300 Species:Arabidopsis thaliana


Alignment Length:286 Identity:69/286 - (24%)
Similarity:115/286 - (40%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WPLVLFYIHLNILGVYGIYVLLT--SASWATILFTALLTLLGTLGVTVGVHRLWAHRTFTASKPL 86
            |||| ..:..:::.:.....||.  :..|..:.|..:|..|.||.:|...||..:||:|...|.|
plant    29 WPLV-DVVRASVVVIVHFLCLLAPFNFKWEALRFGLVLFALTTLSITFSFHRNLSHRSFKIPKWL 92

  Fly    87 KVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQV----RGGLLKYSPQQEE 147
            :....:....|.||.....|..||.||.....|.||:..|...:::.:    ....:||.....:
plant    93 EYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIFDTQYIKYKCGGRD 157

  Fly   148 LLKDVDMSDLESDPVVMFQKR--------FYVLLYIFLNVLLSVNTPFQYFGDSLATSMFVGF-- 202
                 ::.||:......|.:|        |:.:||::..:      |:...|..:  .:|:|:  
plant   158 -----NVLDLKKQWFYKFLRRTIAVHILMFWTILYLYGGL------PYLTCGGGV--GIFIGYHV 209

  Fly   203 -WLRSLIVINLGNLVHSSHFIWSIHK-GFKPTDSN----SIFLITKSYWPQYHYLLPRDYQSG-E 260
             |           ||:|:..||.... ..|.|..|    |:|.:.:| |...|:......:.| |
plant   210 TW-----------LVNSACHIWGSRSWNTKDTSRNVWWLSLFTMGES-WHNNHHAFESSARQGLE 262

  Fly   261 YGNYASGIGSSMIRVFAALDWAKDLK 286
            :  :...|...:||:|..|..|.|:|
plant   263 W--WQIDITWYLIRLFEVLGIATDVK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 62/257 (24%)
ADS4NP_172124.2 PLN02220 1..300 CDD:177866 69/286 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.