DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and ADS2

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001323798.1 Gene:ADS2 / 817694 AraportID:AT2G31360 Length:307 Species:Arabidopsis thaliana


Alignment Length:316 Identity:80/316 - (25%)
Similarity:124/316 - (39%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTKVKEPDQSGDS----IHKKRDAIWPL--------------VLFYIHLNILGVYGIYVLLTSAS 49
            |:.|:|..|...|    :.:|:...|..              ..|.:|  .|.:...:....||.
plant     4 TSTVEENHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVH--SLALLAPFYFTWSAL 66

  Fly    50 WATILFTALLTLLGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHA 114
            |.|.||..    :|.||:||..||..|||:|...|.|:..|.:|...|.||.....|..||.||.
plant    67 WVTFLFYT----IGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQ 127

  Fly   115 KFQQDEDPYYSKHSFMYAQVRGGLLKYSPQQ--EELLKDVDMSDLESDPVVMFQKR---FYVL-L 173
            ....:.||:..|..|.::.:   |..|....  .:..:..::.||:......|.::   |::| |
plant   128 FTDSERDPHSPKEGFWFSHL---LWIYDSAYLVSKCGRRANVEDLKRQWFYRFLQKTVLFHILGL 189

  Fly   174 YIFLNVLLSVNTPFQYFGDSLAT-SMFVGFWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN-- 235
            ..||         |...|.|..| .|.||..|...:...:.:|.|    ||.. :.:|..|::  
plant   190 GFFL---------FYLGGMSFVTWGMGVGAALEVHVTCLINSLCH----IWGT-RTWKTNDTSRN 240

  Fly   236 ----SIFLITKSYWPQYHYLLPRDYQSG-EYGNYASGIGSSMIRVFAALDWAKDLK 286
                |:|...:| |...|:......:.| |:  :...|...::|.|..:..|.|:|
plant   241 VWWLSVFSFGES-WHNNHHAFESSARQGLEW--WQIDISWYIVRFFEIIGLATDVK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 67/250 (27%)
ADS2NP_001323798.1 PLN02220 1..307 CDD:177866 80/316 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.