DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and CG8630

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster


Alignment Length:352 Identity:102/352 - (28%)
Similarity:162/352 - (46%) Gaps:44/352 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PDQSGDSIHKKRDA------------IWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTL 61
            |.|   .:.||.:|            :|..|..::.|:.:.:||:|::...:::..:|.......
  Fly    40 PSQ---KVAKKAEAKTPENKPYELEIVWRNVGLFVILHSMALYGLYLVFAESAYWELLPVYATMF 101

  Fly    62 LGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSK 126
            ||.||:|.||||||:|:.:.|..||::|||.||:.|.|.||:...:.||:||.......||:.|:
  Fly   102 LGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSR 166

  Fly   127 HSFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFG 191
            ..|.:|.:...:.|..|......|.:.|.|:|.||||||||:.|.::.......|.:..|:...|
  Fly   167 RGFFFAHMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMG 231

  Fly   192 DSLATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHK-----GFKPTDSNSIFLITK--------S 243
            .||....|....||..:         |.||.|.::.     |.||.|.|...:..|        .
  Fly   232 SSLRVCFFTCSMLRFCL---------SLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGE 287

  Fly   244 YWPQYHYLLPRDYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETGRPIV 308
            .|..||::.|.||::.|.|.|:....::.|.|.|.:..|.|||.:....|.:.:.:..: |..|.
  Fly   288 GWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGD-GSHIA 351

  Fly   309 ECIEEQVELEENALPANHF---LNREK 332
            ..::..   ..:|:|.:..   |:.||
  Fly   352 ALLDAN---NNSAIPTSELVAHLDHEK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 81/249 (33%)
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 81/248 (33%)
FA_desaturase 91..297 CDD:278890 70/214 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
98.920

Return to query results.
Submit another query.