DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and Scd3

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_077770.1 Gene:Scd3 / 30049 MGIID:1353437 Length:359 Species:Mus musculus


Alignment Length:307 Identity:93/307 - (30%)
Similarity:153/307 - (49%) Gaps:27/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRL 74
            |:.|..  .|.:.:|..::....|::..:||| .|:.|....|.||..:..::...|:..|||||
Mouse    61 DEEGPP--PKLEYVWRNIILMALLHVGALYGI-TLVPSCKLYTCLFAFVYYVISIEGIGAGVHRL 122

  Fly    75 WAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLL 139
            |:|||:.|..||::||:...|.|.|..:|...:.||.||...:...||:.|:..|.::.|...|:
Mouse   123 WSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLV 187

  Fly   140 KYSPQQEELLKDVDMSDLESDPVVMFQKRFY---VLLYIFLNVLLSVNTPFQYFGDSLATSMFVG 201
            :..|..:|....:|||||:::.:||||:|:|   :||..|   :|....|:..:|::...|.:|.
Mouse   188 RKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLMCF---ILPTLVPWYCWGETFLNSFYVA 249

  Fly   202 FWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN---------SIFLITKSYWPQYHYLLPRDYQ 257
            ..||..:|:|...||:|:..::    |::|.|.|         |:..:.:.: ..||:..|.||.
Mouse   250 TLLRYAVVLNATWLVNSAAHLY----GYRPYDKNIDPRQNALVSLGSMGEGF-HNYHHAFPYDYS 309

  Fly   258 SGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
            :.|| .:.....:..|...|||..|.|.|.:....|   |.:...||
Mouse   310 ASEY-RWHINFTTFFIDCMAALGLAYDRKRVSKATV---LARIKRTG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 78/248 (31%)
Scd3NP_077770.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Delta9-FADS-like 97..337 CDD:239582 78/248 (31%)
FA_desaturase 102..306 CDD:278890 66/211 (31%)
Histidine box-1. /evidence=ECO:0000305 120..125 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 157..161 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 298..302 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.