DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AgaP_AGAP001713

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_003435911.1 Gene:AgaP_AGAP001713 / 1281461 VectorBaseID:AGAP001713 Length:355 Species:Anopheles gambiae


Alignment Length:310 Identity:92/310 - (29%)
Similarity:163/310 - (52%) Gaps:12/310 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETTKVKEPDQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLG 66
            :.|.:|..::      :|...:|..|:.:.:|::..|||.:::||||...||.|..:|.::..||
Mosquito    28 DVTPLKRAEK------RKIKLVWRNVIAFGYLHLAAVYGAFLMLTSARLYTIAFAFVLYVVSGLG 86

  Fly    67 VTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMY 131
            :|.|.|||||||::.|..||::.|....|.|.|.......:.||:||...:.|.||:.:...|.:
Mosquito    87 ITAGAHRLWAHRSYKAKLPLRIILAVFNTIAFQDCALHWARDHRVHHKYSETDADPHNATRGFFF 151

  Fly   132 AQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLAT 196
            :.:...|.:..|:.....|.:|::|||:|||:.||::.|::|......:|...||..::.::...
Mosquito   152 SHIGWLLCRKHPEVIAKGKQLDIADLEADPVLRFQRKHYMILMPLACFVLPTITPVYFWNETWTN 216

  Fly   197 SMFVGFWLRSLIVINLGNLVHSSHFIWS---IHKGFKPTDSNSI--FLITKSYWPQYHYLLPRDY 256
            :.||....|...::|:..||:|:...|.   ..|...|:::.::  |...:. |..||::.|.||
Mosquito   217 AWFVATLFRWTFILNVTWLVNSAAHKWGDKPYDKSISPSENRTVASFAFGEG-WHNYHHVFPWDY 280

  Fly   257 QSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETGRP 306
            ::.|.|||...:.::.|..||.:.||.||||:....|.:.:.:..:...|
Mosquito   281 KTAELGNYRMNLTTAFIDFFAKIGWAYDLKTVSKEIVEKRVKRTGDGSHP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 74/241 (31%)
AgaP_AGAP001713XP_003435911.1 Delta9-FADS-like 72..310 CDD:239582 74/238 (31%)
FA_desaturase 73..277 CDD:278890 60/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.