| Sequence 1: | NP_651780.1 | Gene: | CG15531 / 43592 | FlyBaseID: | FBgn0039755 | Length: | 334 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_652731.1 | Gene: | Desat1 / 117369 | FlyBaseID: | FBgn0086687 | Length: | 383 | Species: | Drosophila melanogaster |
| Alignment Length: | 307 | Identity: | 97/307 - (31%) |
|---|---|---|---|
| Similarity: | 168/307 - (54%) | Gaps: | 17/307 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 METTK---VKEPDQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLL 62
Fly 63 GTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKH 127
Fly 128 SFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGD 192
Fly 193 SLATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHK-GFKPTD-----SNSIFLITKSY---WPQY 248
Fly 249 HYLLPRDYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQ 295 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15531 | NP_651780.1 | Delta9-FADS-like | 49..286 | CDD:239582 | 81/245 (33%) |
| Desat1 | NP_652731.1 | Delta9-FADS-like | 97..338 | CDD:239582 | 81/245 (33%) |
| FA_desaturase | 98..305 | CDD:278890 | 69/211 (33%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1398 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 138 | 1.000 | Inparanoid score | I1806 |
| Isobase | 1 | 0.950 | - | 0.837287 | Normalized mean entropy | S1208 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D971318at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000495 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm1155 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11351 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X207 | |
| 9 | 8.920 | |||||