DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AgaP_AGAP013071

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_003436367.1 Gene:AgaP_AGAP013071 / 11175840 VectorBaseID:AGAP013071 Length:396 Species:Anopheles gambiae


Alignment Length:282 Identity:89/282 - (31%)
Similarity:147/282 - (52%) Gaps:20/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NILGVYGIYVLLTSASWATILFTALLTLL--------GTLGVTVGVHRLWAHRTFTASKPLKVFL 90
            |:|.:.|:::......:..:.::.|.|.|        ...|||.|.||||.||.:.|..||::.|
Mosquito    93 NVLMIGGLHLTTVIMFFKYVWYSTLTTWLWGFFVGGCAGFGVTAGAHRLWTHRAYKAKLPLRIIL 157

  Fly    91 MFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLLKYSPQQEELLKDVDMS 155
            |.|...:||.|::..|:.||:||...:.|.||:.|...|.||.|...|::..|:..:..:.:|||
Mosquito   158 MCCYCLSGQNSLFDWVRDHRIHHKYSETDADPHNSNRGFFYAHVGWLLIRKHPECIKKGRLIDMS 222

  Fly   156 DLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLATSMFVGFWLRSLIVINLGNLVHSSH 220
            |:.:|||:.|.:|:::.|.|....|:....|:.:.|:.|..|......||.::.:|...||:|:.
Mosquito   223 DVLADPVIQFHQRYFMALKILFTFLVPSMVPWLFLGEPLYLSFLANCLLRYVLTLNFTWLVNSAA 287

  Fly   221 FIWSIHKGFKPTDS-------NSIFLITKSY-WPQYHYLLPRDYQSGEYGNYASGIGSSMIRVFA 277
            .|:    |.||.||       .::.:::... |..||::.|.||::.|.|:|:..:.:..:.|||
Mosquito   288 HIY----GNKPYDSRIRPAENRAVSIVSMGEGWHNYHHVFPWDYKAAEMGHYSVNVTTFWLDVFA 348

  Fly   278 ALDWAKDLKTIGSVAVRQGLTK 299
            .:.||.|||......||:.|.|
Mosquito   349 KIGWAYDLKEPSKELVRRTLEK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 80/252 (32%)
AgaP_AGAP013071XP_003436367.1 Delta9-FADS-like 116..357 CDD:239582 80/244 (33%)
FA_desaturase 121..324 CDD:278890 66/206 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.