DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc2 and CAM8

DIOPT Version :10

Sequence 1:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_193200.1 Gene:CAM8 / 827114 AraportID:AT4G14640 Length:151 Species:Arabidopsis thaliana


Alignment Length:147 Identity:45/147 - (30%)
Similarity:76/147 - (51%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIANDKELDAMLGE----ASGPINFT 130
            :..::.||.||||||.|.|.|.||.|...:|.....|:.:...::||..::.|    ::|.|.|.
plant     4 TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFA 68

  Fly   131 QLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLMNFGDKFTMKEVDDAYDQM 193
            :.|.|.|.::..|   |.:|.:..|||.||.|  |.|...:...:::|.|:|.|.:||:....:.
plant    69 EFLNLMAKKLQES---DAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEA 130

  Fly   194 VIDDKNQIDTAALIEML 210
            .:|...|::....::|:
plant   131 DLDGDGQVNYDEFVKMM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 45/144 (31%)
CAM8NP_193200.1 PTZ00184 6..148 CDD:185504 45/145 (31%)

Return to query results.
Submit another query.