DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jasper and hdgfl3

DIOPT Version :10

Sequence 1:NP_651768.1 Gene:Jasper / 43576 FlyBaseID:FBgn0039743 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001012372.1 Gene:hdgfl3 / 497284 ZFINID:ZDB-GENE-050213-2 Length:201 Species:Danio rerio


Alignment Length:191 Identity:58/191 - (30%)
Similarity:76/191 - (39%) Gaps:57/191 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YSIGDLVFAKVKGYPPWPAKITKSNNN------KKYNVYFYGTGETANIKLEDLFPYASNKERFA 68
            |..|||||||:||||.|||:|.:....      .||.::|:||.|||.:..:||.||...|::|.
Zfish     9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLLPYKDYKDKFG 73

  Fly    69 TEKIMKRAKFIEAIDQIE-----------------SALRGEDSAPIDLLDGAEPVAPPTTGDGVK 116
              |..||..|.|.:.:||                 |...||..   :..||:      :.||...
Zfish    74 --KSNKRKGFNEGLWEIENNPGVKFTGFQVMQQSSSETEGEGG---NAADGS------SDGDSAA 127

  Fly   117 TEEPKPEPGPEPATAAPVAAAAEKPKKSGTRKTKAPPRHVDGD--------------SEAG 163
            .|:.......:         |..|.|||.:.|.....|...||              ||||
Zfish   128 EEDEAQMKSDK---------AGSKRKKSTSSKVSKQCRKGSGDEDLERDGKDEQKSGSEAG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JasperNP_651768.1 PWWP_HRP 10..86 CDD:438959 35/81 (43%)
LEDGF 320..440 CDD:463284
hdgfl3NP_001012372.1 PWWP_HDGFL3 4..96 CDD:438978 37/88 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.