DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and SLC25A52

DIOPT Version :8

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001029344.3 Gene:SLC25A52 / 147407 HGNCID:23324 Length:307 Species:Homo sapiens

Alignment Length:305 Identity:128/306 (42%)
Similarity:181/306 (59%) Gaps:18/306 (6%)


  Fly    17 PPKRFPSGRAHSPHGDGEAGKLLHGSVFSKRFFGSFQWEEFACGCGAAFVNIAVTYPIYKMIFRQ 81
            ||....|.:..||| ....|::.|                :.|||.|||.|:|:||||.|::|||
Human    21 PPILTSSKQDISPH-ITNVGEMKH----------------YLCGCCAAFNNVAITYPIQKVLFRQ 68

  Fly    82 MLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVL 146
            .|:|:....|..|||.:|...||||:||||.|||.:|::|||:::.....|.:..|..::....:
Human    69 QLYGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFATHGV 133

  Fly   147 AAVVAGSAESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSN 211
            |||:||:||:|..|.|||||||.:.|.|..|:||..||: .:..||..|.||||.|:.:||||||
Human   134 AAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFK-ALKCHGIGEYYRGLVPILFRNGLSN 197

  Fly   212 ALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQ 276
            .|||.||......||...:.|...|.:||.|.::||.:..:.:|:||:|..|||::|...:...:
Human   198 VLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQSQIGGEFQSFPK 262

  Fly   277 ACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKLM 321
            ..::|::||||::.|.:||...|..||.|||||:|..||.|.|.:
Human   263 VFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 39/82 (48%)
Mito_carr 141..229 CDD:278578 44/88 (50%)
Mito_carr 235..322 CDD:278578 35/88 (40%)
SLC25A52NP_001029344.3 Mito_carr 41..122 CDD:278578 40/97 (41%)
Mito_carr 128..213 CDD:278578 44/86 (51%)
Mito_carr <239..307 CDD:278578 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1519
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3315
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D503015at33208
OrthoFinder 1 1.000 FOG0001945
OrthoInspector 1 1.000 T609209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46131
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3422
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.