DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sry-alpha and Spt

Sequence 1:NP_001303490.1 Gene:Sry-alpha FlyBaseID:FBgn0003510 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610423.3 Gene:Spt FlyBaseID:FBgn0033348 Length:591 Species:Drosophila melanogaster

Alignment Length:610 Identity:195/611 (32%)
Similarity:315/611 (52%) Gaps:115/611 (19%)


  Fly     1 MEQLLAQLHTCSELIAEGYSSTGNIGWLNEFCATFLDFASDLKARLPEVAPSGANLDVETIFLCL 65
            ||.|..:|..|..::....::..|  |||:.||..|:||:...:   .....|.:...|.:.|||
  Fly     1 MEILRTKLEACLLILNRNNAAAAN--WLNDLCAVLLEFATLAHS---SFCSQGQSECSELVCLCL 60

  Fly    66 TQVVTCITHLERTISME---APHMTRQHFLDRLDWCLRRL--LVSLTQLEGNVTPVKNLEDHSFV 125
            :|::.||..:|.|:.:|   ...::.|:||||:.|||:||  |.|.......|.|     :.||:
  Fly    61 SQIMICIRQVENTMKLECGTTVSVSHQYFLDRIRWCLKRLMHLYSEESSSEAVAP-----ERSFL 120

  Fly   126 ELMDLALDHLDDYMEKLAQQRNNSLHILEESFTED-----------TYQLASIVNHIVRHALAFA 179
            :|:|.|||.|..:          :.|..|.:.|.:           :.:|.:.::.|:..:|.||
  Fly   121 KLVDGALDCLAQF----------TSHSEENTDTSNCPKTPKEVLPLSQKLRANIDLILGQSLGFA 175

  Fly   180 NVAIHSDKKALTALCETLLAECATFHEEAGEPNSGH----RKLEALSLERALYALESFLNEALLH 240
            |||:..||:||:|||:.::.||..|.||..|..|.:    .||.|:::|:|:|.||.|:|:|||.
  Fly   176 NVALSQDKRALSALCQKVIRECNAFQEECKESFSANYLSTLKLRAMTMEQAIYQLEDFINDALLR 240

  Fly   241 LLFVSLIDLENASVEKLKDALQRDPAG---AQELISAFDTNMDRIQQIGVLAIAFSQDIKTKTIV 302
            |:|...:|.|..||:|::..|:..|..   |.|.|:.||.|:||..|||:.||:|:.::|.|||:
  Fly   241 LVFTCFLDFEKFSVDKIRALLRNSPDNDDLADEFIADFDVNIDRATQIGIFAISFAPNLKMKTIM 305

  Fly   303 RSCLASLESLDACIVPALQLPESTSSAH----HAEVLQEHFNQELLIFRNVIHEIIDSCSLINNY 363
            ||||||.||||..::|:||       ||    |:::|::|||:|:..|:..:.|||||.:|:...
  Fly   306 RSCLASFESLDTTLIPSLQ-------AHGSDLHSDILEQHFNEEVAKFKAALQEIIDSRALVGCC 363

  Fly   364 LDMLGERIHVQ----DKSHLKLIVQRGGVVVDHFRLPVNYSGLSED----GKRVHKDLILILREC 420
            |::|...|...    ||..|:.:||...::|:||:|.||..||||.    |:..::..|.:||||
  Fly   364 LEILTSGISATEKLFDKQRLEDLVQISLLLVEHFQLEVNRKGLSETQDRLGEEYYQQFIRVLREC 428

  Fly   421 QAVVNLDVPVDPKRIVKRLKILYSVLAKLRDLICRDNLEPD------------------------ 461
            :|::.....|:|:||:||.|||.::|.||...:.....|.:                        
  Fly   429 KAILMCASQVEPQRILKRFKILRTILRKLHGSLGAGKQEEELPIPLAPLLADDTKGVNEDETHFT 493

  Fly   462 -------SSVASEAQVPSSATRTF----------VRSSRSFGKRHRSFVKQTGNCSVFGPQDSLA 509
                   .|:..:.:..:..||..          ::|.::  |.|.:.:::....:|...:.::|
  Fly   494 GYKTARSGSILYDTERRNRVTRRTDNKLPTNTLDIKSDKA--KPHGNVLRRESLRTVMFKRQNIA 556

  Fly   510 ES-------GHSESDLISFQITEIL 527
            ||       .:..:||   |||:||
  Fly   557 ESRKLYTSMSNQSTDL---QITDIL 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sry-alphaNP_001303490.1 Serendipity_A 1..530 CDD:283204 195/611 (32%)
SptNP_610423.3 Serendipity_A 1..468 CDD:283204 178/494 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140870249
eggNOG 1 0.900 E1_2E4FC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.